Gene/Proteome Database (LMPD)

LMPD ID
LMP012746
Gene ID
79240
Species
Rattus norvegicus (Rat)
Gene Name
nuclear receptor subfamily 4, group A, member 1
Gene Symbol
Nr4a1
Synonyms
HMR; Nur77; Ngfi-b;
Alternate Names
nuclear receptor subfamily 4 group A member 1; Orphan nuclear receptor HMR; nerve growth factor induced protein I-B; nerve growth factor-induced protein I-B; immediate early gene transcription factor NGFI-B;
Chromosome
7
Map Location
7q36
Summary
putative ligand-dependent transcriptional activator [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Nr4a1

Proteins

nuclear receptor subfamily 4 group A member 1
Refseq ID NP_077364
Protein GI 399498497
UniProt ID P22829
mRNA ID NM_024388
Length 597
MPCIQAQYGTPATSPGPRDHLTGDPLALEFSKPTMDLASPETAPTAPATLPSFSTFMDGGYTGEFDTFLYQLPGTAQPCSSASSTSSSSSSATSPASASFKFEDFQVYGCYPGTLSGPLDETLSSSGSDYYGSPCSAPSPPTPNFQPSQLSPWDGSFGHFSPSQTYEGLRVWTEQLPKASGPPPPPTFFSFSPPTGPSPSLAQSSLKLFPAPATHQLGEGESYSVPAAFPGLAPTSPNCDTSGILDAPVTSTKARSGSSGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPTNLLTSLIRAHLDSGPNTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLDVIRKWAEKIPGFIELSPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKEHMAAVAGDPQPASCLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF

Gene Information

Entrez Gene ID
79240
Gene Name
nuclear receptor subfamily 4, group A, member 1
Gene Symbol
Nr4a1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0005634 IDA:RGD C nucleus
GO:0005667 IEA:Ensembl C transcription factor complex
GO:0000978 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001077 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0004879 IEA:InterPro F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0002042 IEA:Ensembl P cell migration involved in sprouting angiogenesis
GO:0044344 IEA:Ensembl P cellular response to fibroblast growth factor stimulus
GO:0035924 IEA:Ensembl P cellular response to vascular endothelial growth factor stimulus
GO:0035767 IEA:Ensembl P endothelial cell chemotaxis
GO:0043154 IEA:Ensembl P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043065 IEA:Ensembl P positive regulation of apoptotic process
GO:0001938 IEA:Ensembl P positive regulation of endothelial cell proliferation
GO:0035914 IEA:Ensembl P skeletal muscle cell differentiation

KEGG Pathway Links

KEGG Pathway ID Description
ko04010 MAPK signaling pathway
rno04010 MAPK signaling pathway
ko04151 PI3K-Akt signaling pathway
rno04151 PI3K-Akt signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5954012 AKT phosphorylates targets in the nucleus
5953415 Adaptive Immune System
5954570 Constitutive PI3K/AKT Signaling in Cancer
5953408 DAP12 interactions
5953407 DAP12 signaling
5953253 Disease
5953396 Downstream signal transduction
5953994 Downstream signaling events of B Cell Receptor (BCR)
5953399 Downstream signaling of activated FGFR
5953417 Fc epsilon receptor (FCERI) signaling
5953884 GAB1 signalosome
5953330 Gene Expression
5953833 Generic Transcription Pathway
5953410 Immune System
5953409 Innate Immune System
5953394 NGF signalling via TRKA from the plasma membrane
5954147 Nuclear Receptor transcription pathway
5953885 PI-3K cascade
5953996 PI3K events in ERBB2 signaling
5953995 PI3K events in ERBB4 signaling
5953997 PI3K/AKT Signaling in Cancer
5953989 PI3K/AKT activation
5953993 PIP3 activates AKT signaling
5953998 Role of LAT2/NTAL/LAB on calcium mobilization
5953381 Signal Transduction
5953403 Signaling by EGFR
5953404 Signaling by EGFR in Cancer
5953406 Signaling by ERBB2
5953540 Signaling by ERBB4
5953400 Signaling by FGFR
5953401 Signaling by FGFR in disease
5953397 Signaling by PDGF
5953541 Signaling by SCF-KIT
5953414 Signaling by the B Cell Receptor (BCR)
5953395 Signalling by NGF

Domain Information

InterPro Annotations

Accession Description
IPR003071 Nuc_orp_HMR_rcpt
IPR003070 Nuc_orph_rcpt
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
nuclear receptor subfamily 4, group A, member 1
Protein Entry
NR4A1_RAT
UniProt ID
P22829
Species
Rat

Comments

Comment Type Description
Function Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'- AAAAGGTCA-3'. May inhibit NF-kappa-B transactivation of IL2. Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation (By similarity)
Induction By nerve growth factor and during liver regeneration.
Ptm Acetylated by p300/CBP, acetylation increases stability. Deacetylated by HDAC1 (By similarity)
Ptm Phosphorylated at Ser-350 by RPS6KA1 and RPS6KA3 in response to mitogenic or stress stimuli (By similarity). Phosphorylation of Ser-350 results in decrease in NBRE binding while phosphorylation of Ser-340 has little effect on it. {ECO:0000250, ECO:0000269|PubMed:8227042}.
Sequence Caution Sequence=AAA56770.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH97313.2; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the nuclear hormone receptor family. NR4 subfamily
Similarity Contains 1 nuclear receptor DNA-binding domain
Subcellular Location Cytoplasm . Nucleus.
Subunit Interacts with GADD45GIP1. Interacts with STK11 (By similarity). Binds DNA as a monomer. {ECO:0000250, ECO:0000269|PubMed:10331876}.
Tissue Specificity Expressed in lung, brain and superior cervical ganglia. High levels are seen in the adrenal tissue.

Identical and Related Proteins

Unique RefSeq proteins for LMP012746 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
399498497 RefSeq NP_077364 597 nuclear receptor subfamily 4 group A member 1

Identical Sequences to LMP012746 proteins

Reference Database Accession Length Protein Name
GI:399498497 GenBank EDL86903.1 597 nuclear receptor subfamily 4, group A, member 1 [Rattus norvegicus]
GI:399498497 RefSeq XP_006242418.1 597 PREDICTED: nuclear receptor subfamily 4 group A member 1 isoform X1 [Rattus norvegicus]
GI:399498497 RefSeq XP_006242420.1 597 PREDICTED: nuclear receptor subfamily 4 group A member 1 isoform X1 [Rattus norvegicus]
GI:399498497 SwissProt P22829.2 597 RecName: Full=Nuclear receptor subfamily 4 group A member 1; AltName: Full=NUR77; AltName: Full=Nerve growth factor-induced protein I-B; Short=NGFI-B; AltName: Full=Orphan nuclear receptor HMR [Rattus norvegicus]

Related Sequences to LMP012746 proteins

Reference Database Accession Length Protein Name
GI:399498497 RefSeq XP_006242418.1 597 PREDICTED: nuclear receptor subfamily 4 group A member 1 isoform X1 [Rattus norvegicus]
GI:399498497 RefSeq XP_006242420.1 597 PREDICTED: nuclear receptor subfamily 4 group A member 1 isoform X1 [Rattus norvegicus]
GI:399498497 SwissProt P22829.2 597 RecName: Full=Nuclear receptor subfamily 4 group A member 1; AltName: Full=NUR77; AltName: Full=Nerve growth factor-induced protein I-B; Short=NGFI-B; AltName: Full=Orphan nuclear receptor HMR [Rattus norvegicus]