Gene/Proteome Database (LMPD)
LMPD ID
LMP012748
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 2
Gene Symbol
Alternate Names
estradiol 17-beta-dehydrogenase 2; 17-beta-HSD 2; testosterone 17-beta-dehydrogenase; 17-beta-hydroxysteroid dehydrogenase 2; 17-beta hydroxysteroid dehydrogenase type 2; 17-beta-hydroxysteroid dehydrogenase type 2;
Chromosome
19
Map Location
19q12
EC Number
1.1.1.62
Summary
17-beta hydroxysteroid enzyme that regulates the biological activity of sex hormones, including estrogen and androgens [RGD, Feb 2006]
Orthologs
Proteins
| estradiol 17-beta-dehydrogenase 2 | |
|---|---|
| Refseq ID | NP_077367 |
| Protein GI | 13242301 |
| UniProt ID | Q62730 |
| mRNA ID | NM_024391 |
| Length | 381 |
| MNPFSSESAWLCLTATAVLGGMLLCKAWSSGQLRSQVVCLAGLWGGACLLSLSLLCSLFLLSVSCFFLLYVSSSDQDLLPVDQKAVLVTGADSGFGHALAKHLDKLGFTVFAGVLDKEGPGAEELRKNCSERLSVLQMDVTKPEQIKDVHSEVAEKIQDKGLWAVVNNAGVLHFPIDGELIPMTVYRKCMAVNFFGAVEVTKVFLPLLRKSKGRLVNVSSMGAMIPFQMVAAYASTKAAISMFSAVIRQELAKWGVKVVTIHPGGFQTNIVGSQDSWDKMEKEILDHFSKEIQENYGQEYVHTQKLALPVMREMSNPDITPVLRDIQHAICAKNPSSFYCSGRMTYLWICFAAYSPISLLDYILKNYFTPKLMPRALRTAS | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0043231 | IDA:RGD | C | intracellular membrane-bounded organelle |
| GO:0004303 | IDA:RGD | F | estradiol 17-beta-dehydrogenase activity |
| GO:0047035 | IDA:RGD | F | testosterone dehydrogenase (NAD+) activity |
| GO:0006702 | IDA:RGD | P | androgen biosynthetic process |
| GO:0060348 | IEP:RGD | P | bone development |
| GO:0071248 | IEP:RGD | P | cellular response to metal ion |
| GO:0006703 | IDA:RGD | P | estrogen biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 2
Protein Entry
DHB2_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. |
| Catalytic Activity | Testosterone + NAD(+) = androstenedione + NADH. |
| Function | Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Favors the oxidation of estradiol and testosterone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH (By similarity) |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
| Subcellular Location | Membrane ; Single-pass type II membrane protein . |
| Tissue Specificity | Highest expression in placenta. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012748 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13242301 | RefSeq | NP_077367 | 381 | estradiol 17-beta-dehydrogenase 2 |
Identical Sequences to LMP012748 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13242301 | EMBL | CAA62617.1 | 381 | 17-beta hydroxysteroid dehydrogenase type 2 [Rattus norvegicus] |
| GI:13242301 | GenBank | AEK13592.1 | 381 | Sequence 4 from patent US 7972785 |
| GI:13242301 | SwissProt | Q62730.1 | 381 | RecName: Full=Estradiol 17-beta-dehydrogenase 2; AltName: Full=17-beta-hydroxysteroid dehydrogenase type 2; Short=17-beta-HSD 2; AltName: Full=Testosterone 17-beta-dehydrogenase [Rattus norvegicus] |
Related Sequences to LMP012748 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13242301 | EMBL | CAA62617.1 | 381 | 17-beta hydroxysteroid dehydrogenase type 2 [Rattus norvegicus] |
| GI:13242301 | GenBank | AEK13592.1 | 381 | Sequence 4 from patent US 7972785 |
| GI:13242301 | SwissProt | Q62730.1 | 381 | RecName: Full=Estradiol 17-beta-dehydrogenase 2; AltName: Full=17-beta-hydroxysteroid dehydrogenase type 2; Short=17-beta-HSD 2; AltName: Full=Testosterone 17-beta-dehydrogenase [Rattus norvegicus] |