Gene/Proteome Database (LMPD)
LMPD ID
LMP012784
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
Inositol (myo)-1(or 4)-monophosphatase 1
Gene Symbol
Synonyms
Impa1-L;
Alternate Names
inositol monophosphatase 1; IMP 1; IMPase 1; inositol-1(or 4)-monophosphatase 1; D-galactose 1-phosphate phosphatase; lithium-sensitive myo-inositol monophosphatase A1;
Chromosome
2
Map Location
2q23
EC Number
3.1.3.25
Summary
enzyme which controls the levels of brain inositol [RGD, Feb 2006]
Orthologs
Proteins
| inositol monophosphatase 1 | |
|---|---|
| Refseq ID | NP_114446 |
| Protein GI | 14091736 |
| UniProt ID | P97697 |
| mRNA ID | NM_032057 |
| Length | 277 |
| MADPWQECMDYAVILARQAGEMIREALKNKMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPYHSFIGEESVASGEKTVFTEQPTWIIDPIDGTTNFVHRFPFVAVSIGFVVNKEMEFGVVYSCVEDKMYTGRKGKGAFCNGQKLRVSQQEDITKSLLVTELGSSRKPETLRIVLSNMERLCSIPIHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVIEAGGVLLDVTGGPFDLMSRRIIAASNIALAERIAKELEIIPLQRDDES | |
Gene Information
Entrez Gene ID
Gene Name
Inositol (myo)-1(or 4)-monophosphatase 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030424 | IDA:BHF-UCL | C | axon |
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0043025 | IDA:BHF-UCL | C | neuronal cell body |
| GO:0008934 | IDA:RGD | F | inositol monophosphate 1-phosphatase activity |
| GO:0052832 | IEA:UniProtKB-EC | F | inositol monophosphate 3-phosphatase activity |
| GO:0052833 | IEA:UniProtKB-EC | F | inositol monophosphate 4-phosphatase activity |
| GO:0052834 | IDA:UniProtKB | F | inositol monophosphate phosphatase activity |
| GO:0031403 | IDA:UniProtKB | F | lithium ion binding |
| GO:0000287 | IDA:UniProtKB | F | magnesium ion binding |
| GO:0030145 | IDA:UniProtKB | F | manganese ion binding |
| GO:0006021 | IEA:UniProtKB-UniPathway | P | inositol biosynthetic process |
| GO:0046855 | IDA:UniProtKB | P | inositol phosphate dephosphorylation |
| GO:0006661 | IMP:RGD | P | phosphatidylinositol biosynthetic process |
| GO:0046854 | IEA:InterPro | P | phosphatidylinositol phosphorylation |
| GO:0010226 | IEP:RGD | P | response to lithium ion |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00562 | Inositol phosphate metabolism |
| rno00562 | Inositol phosphate metabolism |
| M00131 | Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol |
| rno01100 | Metabolic pathways |
| ko04070 | Phosphatidylinositol signaling system |
| rno04070 | Phosphatidylinositol signaling system |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Inositol (myo)-1(or 4)-monophosphatase 1
Protein Entry
IMPA1_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Alpha-D-galactose 1-phosphate + H(2)O = D- galactose + phosphate |
| Catalytic Activity | Myo-inositol phosphate + H(2)O = myo-inositol + phosphate |
| Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; |
| Enzyme Regulation | Activity with myo-inositol monophosphate and D- galactose 1-phosphate is inhibited by Li(+), Ca(2+) and Mn(2+), but also by Mg(2+) at concentrations above 3 mM |
| Function | Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. Has broad substrate specificity and can use myo- inositol 1,3-diphosphate, myo-inositol 1,4-diphosphate, scyllo- inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates (By similarity). Is equally active with myo-inositol monophosphate and D-galactose 1-phosphate |
| Pathway | Polyol metabolism; myo-inositol biosynthesis; myo- inositol from D-glucose 6-phosphate: step 2/2. |
| Similarity | Belongs to the inositol monophosphatase family |
| Subcellular Location | Cytoplasm . |
| Subunit | Homodimer |
| Tissue Specificity | Ubiquitous |
Identical and Related Proteins
Unique RefSeq proteins for LMP012784 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 14091736 | RefSeq | NP_114446 | 277 | inositol monophosphatase 1 |
Identical Sequences to LMP012784 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14091736 | GenBank | AAB63338.2 | 277 | myo-inositol monophosphatase [Rattus norvegicus] |
| GI:14091736 | SwissProt | P97697.2 | 277 | RecName: Full=Inositol monophosphatase 1; Short=IMP 1; Short=IMPase 1; AltName: Full=D-galactose 1-phosphate phosphatase; AltName: Full=Inositol-1(or 4)-monophosphatase 1; AltName: Full=Lithium-sensitive myo-inositol monophosphatase A1 [Rattus norvegicus] |
Related Sequences to LMP012784 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14091736 | GenBank | AAB63338.2 | 277 | myo-inositol monophosphatase [Rattus norvegicus] |
| GI:14091736 | RefSeq | XP_006232213.1 | 330 | PREDICTED: inositol monophosphatase 1 isoform X1 [Rattus norvegicus] |
| GI:14091736 | SwissProt | P97697.2 | 277 | RecName: Full=Inositol monophosphatase 1; Short=IMP 1; Short=IMPase 1; AltName: Full=D-galactose 1-phosphate phosphatase; AltName: Full=Inositol-1(or 4)-monophosphatase 1; AltName: Full=Lithium-sensitive myo-inositol monophosphatase A1 [Rattus norvegicus] |