Gene/Proteome Database (LMPD)

LMPD ID
LMP012792
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
G protein-coupled receptor 6
Gene Symbol
Alternate Names
G-protein coupled receptor 6; sphingosine 1-phosphate receptor GPR6; putative G protein-coupled receptor (CNL3);
Chromosome
20
Map Location
chromosome:20
Summary
may mediate later differentiation events within the superficial cortical layers during cerebral cortical development [RGD, Feb 2006]
Orthologs

Proteins

G-protein coupled receptor 6
Refseq ID NP_113994
Protein GI 13929142
UniProt ID P51651
mRNA ID NM_031806
Length 363
MNASAAALNESQVVAVAAEGAAAAATAAGTPDTSEWGPPAASAALGGGGGPNGSLELSSQLPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRASCSVVRPLTRSHVALLSTSFFVVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSPSEV

Gene Information

Entrez Gene ID
Gene Name
G protein-coupled receptor 6
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0038036 IEA:Ensembl F sphingosine-1-phosphate receptor activity
GO:0007186 TAS:RGD P G-protein coupled receptor signaling pathway
GO:0007204 IEA:Ensembl P positive regulation of cytosolic calcium ion concentration

Domain Information

InterPro Annotations

Accession Description
IPR000723 G protein-coupled receptor 3/6/12 orphan
IPR001151 G protein-coupled receptor 6
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
G protein-coupled receptor 6
Protein Entry
GPR6_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Developmental Stage Abundantly expressed in granule neurons at all developmental stages
Function Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons
Similarity Belongs to the G-protein coupled receptor 1 family
Subcellular Location Cell membrane ; Multi-pass membrane protein . Note=Detected in the intracellular compartments. It is currently unclear whether this is a cell surface or intracellular receptor (By similarity)
Tissue Specificity Expressed in the brain, with a prominent distribution in striatum

Identical and Related Proteins

Unique RefSeq proteins for LMP012792 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13929142 RefSeq NP_113994 363 G-protein coupled receptor 6

Identical Sequences to LMP012792 proteins

Reference Database Accession Length Protein Name
GI:13929142 GenBank AAA21870.1 363 putative G protein-coupled receptor [Rattus norvegicus]
GI:13929142 GenBank AAC16886.1 363 putative G protein-coupled receptor [Rattus norvegicus]
GI:13929142 GenBank EDL83244.1 363 G protein-coupled receptor 6 [Rattus norvegicus]
GI:13929142 SwissProt P51651.1 363 RecName: Full=G-protein coupled receptor 6; AltName: Full=Sphingosine 1-phosphate receptor GPR6 [Rattus norvegicus]

Related Sequences to LMP012792 proteins

Reference Database Accession Length Protein Name
GI:13929142 GenBank AAA21870.1 363 putative G protein-coupled receptor [Rattus norvegicus]
GI:13929142 GenBank AAC16886.1 363 putative G protein-coupled receptor [Rattus norvegicus]
GI:13929142 SwissProt P51651.1 363 RecName: Full=G-protein coupled receptor 6; AltName: Full=Sphingosine 1-phosphate receptor GPR6 [Rattus norvegicus]