Gene/Proteome Database (LMPD)
LMPD ID
LMP012792
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
G protein-coupled receptor 6
Gene Symbol
Alternate Names
G-protein coupled receptor 6; sphingosine 1-phosphate receptor GPR6; putative G protein-coupled receptor (CNL3);
Chromosome
20
Map Location
chromosome:20
Summary
may mediate later differentiation events within the superficial cortical layers during cerebral cortical development [RGD, Feb 2006]
Orthologs
Proteins
G-protein coupled receptor 6 | |
---|---|
Refseq ID | NP_113994 |
Protein GI | 13929142 |
UniProt ID | P51651 |
mRNA ID | NM_031806 |
Length | 363 |
MNASAAALNESQVVAVAAEGAAAAATAAGTPDTSEWGPPAASAALGGGGGPNGSLELSSQLPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRASCSVVRPLTRSHVALLSTSFFVVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSPSEV |
Gene Information
Entrez Gene ID
Gene Name
G protein-coupled receptor 6
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0038036 | IEA:Ensembl | F | sphingosine-1-phosphate receptor activity |
GO:0007186 | TAS:RGD | P | G-protein coupled receptor signaling pathway |
GO:0007204 | IEA:Ensembl | P | positive regulation of cytosolic calcium ion concentration |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Developmental Stage | Abundantly expressed in granule neurons at all developmental stages |
Function | Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons |
Similarity | Belongs to the G-protein coupled receptor 1 family |
Subcellular Location | Cell membrane ; Multi-pass membrane protein . Note=Detected in the intracellular compartments. It is currently unclear whether this is a cell surface or intracellular receptor (By similarity) |
Tissue Specificity | Expressed in the brain, with a prominent distribution in striatum |
Identical and Related Proteins
Unique RefSeq proteins for LMP012792 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
13929142 | RefSeq | NP_113994 | 363 | G-protein coupled receptor 6 |
Identical Sequences to LMP012792 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13929142 | GenBank | AAA21870.1 | 363 | putative G protein-coupled receptor [Rattus norvegicus] |
GI:13929142 | GenBank | AAC16886.1 | 363 | putative G protein-coupled receptor [Rattus norvegicus] |
GI:13929142 | GenBank | EDL83244.1 | 363 | G protein-coupled receptor 6 [Rattus norvegicus] |
GI:13929142 | SwissProt | P51651.1 | 363 | RecName: Full=G-protein coupled receptor 6; AltName: Full=Sphingosine 1-phosphate receptor GPR6 [Rattus norvegicus] |
Related Sequences to LMP012792 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13929142 | GenBank | AAA21870.1 | 363 | putative G protein-coupled receptor [Rattus norvegicus] |
GI:13929142 | GenBank | AAC16886.1 | 363 | putative G protein-coupled receptor [Rattus norvegicus] |
GI:13929142 | SwissProt | P51651.1 | 363 | RecName: Full=G-protein coupled receptor 6; AltName: Full=Sphingosine 1-phosphate receptor GPR6 [Rattus norvegicus] |