Gene/Proteome Database (LMPD)

LMPD ID
LMP012849
Gene ID
113984
Species
Rattus norvegicus (Rat)
Gene Name
nuclear receptor subfamily 2, group F, member 2
Gene Symbol
Nr2f2
Synonyms
Tfcoup2;
Alternate Names
COUP transcription factor 2; ARP-1; COUPb; COUP-TF2; COUP-TF II; COUP transcription factor II; apolipoprotein AI regulatory protein 1; apolipoprotein A-I regulatory protein 1; ovalbumin upstream promoter beta nuclear receptor;
Chromosome
1
Map Location
1q31
Summary
transcriptional activator or repressor; involved in determining the metabolic phenotype of hepatic cells [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Nr2f2

Proteins

COUP transcription factor 2
Refseq ID NP_542956
Protein GI 18158445
UniProt ID O09018
mRNA ID NM_080778
Length 414
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGSQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ

Gene Information

Entrez Gene ID
113984
Gene Name
nuclear receptor subfamily 2, group F, member 2
Gene Symbol
Nr2f2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IDA:RGD C nucleus
GO:0004879 ISS:UniProtKB F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0001972 ISS:UniProtKB F retinoic acid binding
GO:0043565 IDA:RGD F sequence-specific DNA binding
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0009952 IEA:Ensembl P anterior/posterior pattern specification
GO:0048514 IEA:Ensembl P blood vessel morphogenesis
GO:0009566 IEA:Ensembl P fertilization
GO:0030900 IEA:Ensembl P forebrain development
GO:0030522 ISS:GOC P intracellular receptor signaling pathway
GO:0060173 IEA:Ensembl P limb development
GO:0001893 IEA:Ensembl P maternal placenta development
GO:0045736 IEA:Ensembl P negative regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0010596 IEA:Ensembl P negative regulation of endothelial cell migration
GO:0001937 IEA:Ensembl P negative regulation of endothelial cell proliferation
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0001764 IEA:Ensembl P neuron migration
GO:0060674 IEA:Ensembl P placenta blood vessel development
GO:0045893 ISS:UniProtKB P positive regulation of transcription, DNA-templated
GO:0009956 IEA:Ensembl P radial pattern formation
GO:0060849 IEA:Ensembl P regulation of transcription involved in lymphatic endothelial cell fate commitment
GO:0006355 IMP:RGD P regulation of transcription, DNA-templated
GO:0032355 IEP:RGD P response to estradiol
GO:0007519 IEA:Ensembl P skeletal muscle tissue development
GO:0060707 IEA:Ensembl P trophoblast giant cell differentiation

REACTOME Pathway Links

REACTOME Pathway ID Description
5953533 Developmental Biology
5954166 Transcriptional regulation of white adipocyte differentiation

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR001723 Steroid hormone receptor
IPR003068 Transcription factor COUP
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
nuclear receptor subfamily 2, group F, member 2
Protein Entry
COT2_RAT
UniProt ID
O09018
Species
Rat

Comments

Comment Type Description
Function Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A (By similarity)
Similarity Belongs to the nuclear hormone receptor family. NR2 subfamily
Similarity Contains 1 nuclear receptor DNA-binding domain
Subcellular Location Nucleus.
Subunit Interacts with SQSTM1. Binds DNA as a dimer; homodimer or heterodimer with NR2F6. Interacts with NCOA1, NCOA2, NCOA3 and PPARGC1A. Interacts with ZFPM2 (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012849 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18158445 RefSeq NP_542956 414 COUP transcription factor 2

Identical Sequences to LMP012849 proteins

Reference Database Accession Length Protein Name
GI:18158445 GenBank AAB61297.1 414 ovalbumin upstream promoter beta nuclear receptor rCOUPb [Rattus norvegicus]
GI:18158445 GenBank EDM08487.1 414 nuclear receptor subfamily 2, group F, member 2, isoform CRA_a [Rattus norvegicus]
GI:18158445 SwissProt O09018.1 414 RecName: Full=COUP transcription factor 2; Short=COUP-TF2; AltName: Full=Apolipoprotein A-I regulatory protein 1; Short=ARP-1; AltName: Full=COUP transcription factor II; Short=COUP-TF II; AltName: Full=COUPb; AltName: Full=Nuclear receptor subfamily 2 group F member 2; AltName: Full=Ovalbumin upstream promoter beta nuclear receptor [Rattus norvegicus]

Related Sequences to LMP012849 proteins

Reference Database Accession Length Protein Name
GI:18158445 GenBank AAB61297.1 414 ovalbumin upstream promoter beta nuclear receptor rCOUPb [Rattus norvegicus]
GI:18158445 GenBank EDM08487.1 414 nuclear receptor subfamily 2, group F, member 2, isoform CRA_a [Rattus norvegicus]
GI:18158445 SwissProt O09018.1 414 RecName: Full=COUP transcription factor 2; Short=COUP-TF2; AltName: Full=Apolipoprotein A-I regulatory protein 1; Short=ARP-1; AltName: Full=COUP transcription factor II; Short=COUP-TF II; AltName: Full=COUPb; AltName: Full=Nuclear receptor subfamily 2 group F member 2; AltName: Full=Ovalbumin upstream promoter beta nuclear receptor [Rattus norvegicus]