Gene/Proteome Database (LMPD)
LMPD ID
LMP012863
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Gene Symbol
Synonyms
Pi4KII;
Alternate Names
phosphatidylinositol 4-kinase type 2-alpha; null; phosphatidylinositol 4-kinase type II; phosphatidylinositol 4-kinase type II-alpha; 55 kDa type II phosphatidylinositol 4-kinase;
Chromosome
1
Map Location
1q54
EC Number
2.7.1.67
Summary
catalyzes the conversion of PtdIns to PtdIns 4-phosphate [RGD, Feb 2006]
Orthologs
Proteins
| phosphatidylinositol 4-kinase type 2-alpha | |
|---|---|
| Refseq ID | NP_446187 |
| Protein GI | 16758554 |
| UniProt ID | Q99M64 |
| mRNA ID | NM_053735 |
| Length | 478 |
| MDETSPLVSPERAQPPEYTFPSVSGAHFPQVPGGAVRVAAAGSGPSPPCSPGHDRERQPLLDRARGAAAQGQTHTVAAQAQALAAQAAVAVHAVQTHRERNDFPEDPEFEVVVRQAEIAIECSIYPERIYQGSSGSYFVKDSQGRIIAVFKPKNEEPYGNLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDYPMDNPNCRDTDWVMVREPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031083 | IEA:Ensembl | C | BLOC-1 complex |
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0030054 | IEA:UniProtKB-KW | C | cell junction |
| GO:0031410 | IDA:UniProtKB | C | cytoplasmic vesicle |
| GO:0030425 | ISS:UniProtKB | C | dendrite |
| GO:0031901 | IDA:RGD | C | early endosome membrane |
| GO:0005768 | IDA:UniProtKB | C | endosome |
| GO:0070382 | IDA:RGD | C | exocytic vesicle |
| GO:0035838 | IDA:UniProtKB | C | growing cell tip |
| GO:0044231 | ISS:UniProtKB | C | host cell presynaptic membrane |
| GO:0005887 | IEA:Ensembl | C | integral component of plasma membrane |
| GO:0043231 | IDA:RGD | C | intracellular membrane-bounded organelle |
| GO:0005765 | IEA:Ensembl | C | lysosomal membrane |
| GO:0045121 | IDA:RGD | C | membrane raft |
| GO:0005739 | ISS:UniProtKB | C | mitochondrion |
| GO:0043005 | IDA:UniProtKB | C | neuron projection |
| GO:0043025 | IDA:UniProtKB | C | neuronal cell body |
| GO:0043204 | IDA:RGD | C | perikaryon |
| GO:0005886 | IDA:RGD | C | plasma membrane |
| GO:0042734 | ISS:UniProtKB | C | presynaptic membrane |
| GO:0043234 | IDA:RGD | C | protein complex |
| GO:0030672 | IDA:RGD | C | synaptic vesicle membrane |
| GO:0004430 | IDA:RGD | F | 1-phosphatidylinositol 4-kinase activity |
| GO:0035651 | ISS:UniProtKB | F | AP-3 adaptor complex binding |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0032403 | IDA:RGD | F | protein complex binding |
| GO:0002561 | IMP:RGD | P | basophil degranulation |
| GO:0006661 | IEA:Ensembl | P | phosphatidylinositol biosynthetic process |
| GO:0046854 | IDA:GOC | P | phosphatidylinositol phosphorylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00562 | Inositol phosphate metabolism |
| rno00562 | Inositol phosphate metabolism |
| M00130 | Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4 |
| rno01100 | Metabolic pathways |
| ko04070 | Phosphatidylinositol signaling system |
| rno04070 | Phosphatidylinositol signaling system |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5954478 | PI Metabolism |
| 5953474 | Phospholipid metabolism |
| 5954502 | Synthesis of PIPs at the Golgi membrane |
| 5954503 | Synthesis of PIPs at the early endosome membrane |
| 5954499 | Synthesis of PIPs at the plasma membrane |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000403 | Phosphatidylinositol 3-/4-kinase, catalytic domain |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Protein Entry
P4K2A_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=88 uM for ATP; KM=45 uM for PtdIns; |
| Catalytic Activity | ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate. |
| Function | Together with PI4K2B and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells. This lipid kinase is the major phosphatidylinositol 4-phosphate (PI4P) producer in the Golgi apparatus, it generates more than 50% of this molecule which is essential for the identity of the organelle, protein sorting and membrane trafficking |
| Ptm | Palmitoylated by ZDHHC3 and ZDHHC7 in the CCPCC motif. Palmitoylation is cholesterol-dependent, and required for TGN localization (By similarity) |
| Similarity | Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily |
| Similarity | Contains 1 PI3K/PI4K domain |
| Subcellular Location | Cytoplasm . Golgi apparatus, trans-Golgi network membrane ; Lipid-anchor {ECO:0000250}. Membrane raft . Cell projection, dendrite . Cell junction, synapse, presynaptic cell membrane . Cell junction, synapse, synaptosome {ECO:0000250}. Mitochondrion . Endosome . Cytoplasmic vesicle . Note=Found in subdomains of the plasma membrane termed non-caveolar membrane rafts. Localized in neuronal cell body. Transported from neuronal cell body to neuron projections in a BLOC-1- and AP-3-complexes-dependent manner (By similarity). Enriched in neurite tips and neuron projections in a BLOC-1- and AP-3-complexes-dependent manner |
| Subunit | Associates with the BLOC-1 and the AP-3 complexes; the BLOC-1 complex is required for optimal binding of PI4K2A to the AP-3 complex. Interacts with BLOC1S5 and DTNBP1 (By similarity). Interacts with FOS; this interaction may enhance phosphatidylinositol phosphorylation activity (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP012863 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16758554 | RefSeq | NP_446187 | 478 | phosphatidylinositol 4-kinase type 2-alpha |
Identical Sequences to LMP012863 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16758554 | GenBank | AAK33002.1 | 478 | 55 kDa type II phosphatidylinositol 4-kinase [Rattus norvegicus] |
| GI:16758554 | GenBank | EDL94229.1 | 478 | phosphatidylinositol 4-kinase type 2 alpha, isoform CRA_a [Rattus norvegicus] |
| GI:16758554 | SwissProt | Q99M64.1 | 478 | RecName: Full=Phosphatidylinositol 4-kinase type 2-alpha; AltName: Full=55 kDa type II phosphatidylinositol 4-kinase; AltName: Full=Phosphatidylinositol 4-kinase type II-alpha [Rattus norvegicus] |
Related Sequences to LMP012863 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16758554 | GenBank | AAK33002.1 | 478 | 55 kDa type II phosphatidylinositol 4-kinase [Rattus norvegicus] |
| GI:16758554 | GenBank | EDL94229.1 | 478 | phosphatidylinositol 4-kinase type 2 alpha, isoform CRA_a [Rattus norvegicus] |
| GI:16758554 | SwissProt | Q99M64.1 | 478 | RecName: Full=Phosphatidylinositol 4-kinase type 2-alpha; AltName: Full=55 kDa type II phosphatidylinositol 4-kinase; AltName: Full=Phosphatidylinositol 4-kinase type II-alpha [Rattus norvegicus] |