Gene/Proteome Database (LMPD)
LMPD ID
LMP012864
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylinositol transfer protein, beta
Gene Symbol
Alternate Names
phosphatidylinositol transfer protein beta isoform; PI-TP-beta; ptdInsTP beta; ptdIns transfer protein beta; phosphotidylinositol transfer protein, beta;
Chromosome
12
Map Location
12q16
Summary
complements a yeast sec14 mutation; may act as a phosphotidylinositol transfer protein [RGD, Feb 2006]
Orthologs
Proteins
phosphatidylinositol transfer protein beta isoform | |
---|---|
Refseq ID | NP_446194 |
Protein GI | 16758568 |
UniProt ID | P53812 |
mRNA ID | NM_053742 |
Length | 271 |
MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANTPDCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol transfer protein, beta
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0008526 | IMP:RGD | F | phosphatidylinositol transporter activity |
GO:0015914 | IMP:GOC | P | phospholipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol transfer protein, beta
Protein Entry
PIPNB_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P53812-1; Sequence=Displayed; Name=2; IsoId=P53812-2; Sequence=VSP_012763; |
Function | Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes. |
Ptm | Constitutive phosphorylation of Ser-262 has no effect on phospholipid transfer activity but is required for Golgi targeting |
Similarity | Belongs to the PtdIns transfer protein family. PI transfer class I subfamily |
Subcellular Location | Cytoplasm . Golgi apparatus . |
Tissue Specificity | Expressed abundantly in brain, kidney, liver, and lung, but in a lesser amount in testis. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012864 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16758568 | RefSeq | NP_446194 | 271 | phosphatidylinositol transfer protein beta isoform |
Identical Sequences to LMP012864 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16758568 | DBBJ | BAA04669.1 | 271 | phosphatidylinositol transfer protein [Rattus norvegicus] |
GI:16758568 | SwissProt | P53812.2 | 271 | RecName: Full=Phosphatidylinositol transfer protein beta isoform; Short=PI-TP-beta; Short=PtdIns transfer protein beta; Short=PtdInsTP beta [Rattus norvegicus] |
Related Sequences to LMP012864 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16758568 | DBBJ | BAA04669.1 | 271 | phosphatidylinositol transfer protein [Rattus norvegicus] |
GI:16758568 | PDB | 2A1L | 270 | Chain A, Rat Pitp-Beta Complexed To Phosphatidylcholine |
GI:16758568 | SwissProt | P53812.2 | 271 | RecName: Full=Phosphatidylinositol transfer protein beta isoform; Short=PI-TP-beta; Short=PtdIns transfer protein beta; Short=PtdInsTP beta [Rattus norvegicus] |