Gene/Proteome Database (LMPD)
LMPD ID
LMP012887
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
Gene Symbol
Alternate Names
lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase; BGnT-5; beta3Gn-T5; lc3 synthase; beta-1,3-Gn-T5; lc(3)Cer synthase; lactotriaosylceramide synthase; beta-1,3-N-acetylglucosaminyltransferase 5; beta-1,3-N-acetylglucosaminyltransferase-5; UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5;
Chromosome
11
Map Location
11q23
EC Number
2.4.1.206
Proteins
| lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase | |
|---|---|
| Refseq ID | NP_446384 |
| Protein GI | 281306748 |
| UniProt ID | Q99NB2 |
| mRNA ID | NM_053932 |
| Length | 377 |
| MRVFVSSRRVKRWQFFHLFAICFILSFMVFWGPINNYIMSHMKSYSYRYLINSYDFVNDSLSLKHSSVQPHHPYLINHREKCQAQDVLLLLFIKTAPENYERRSAIRKTWGNENYVQSQLNANIKILFALGTPHPLKGKELQKRLIWEDQVYHDIIQQDFTDSFHNLTFKFLLQFGWANTFCPHARFLMTADDDIFIHMPNLIEYLQGLEQVGVRDFWIGHVHRGGPPVRDKSSKYYVPYEMYKWPAYPDYTAGAAYVVSNDVAAKIYEASQTLNSSMYIDDVFMGLCANKVGVVPQDHVFFSGEGKIPYHPCIYEKMITSHGHSQDLQDLWVEATDPKVKDISKGFFGQIYCRLIKIVLLCRLTYRNSYPCRAAFA | |
Gene Information
Entrez Gene ID
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008457 | IEA:Ensembl | F | beta-galactosyl-N-acetylglucosaminylgalactosylglucosyl-ceramide beta-1,3-acetylglucosaminyltransferase activity |
| GO:0008378 | IEA:InterPro | F | galactosyltransferase activity |
| GO:0047256 | IEA:UniProtKB-EC | F | lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase activity |
| GO:0008917 | IEA:Ensembl | F | lipopolysaccharide N-acetylglucosaminyltransferase activity |
| GO:0007417 | IEA:Ensembl | P | central nervous system development |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| rno00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| M00070 | Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer |
| M00071 | Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002659 | Glycosyl transferase, family 31 |
UniProt Annotations
Entry Information
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
Protein Entry
B3GN5_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-D-glucosamine + beta-D- galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide = UDP + N- acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D- glucosyl-(1<->1)-ceramide. |
| Function | Beta-1,3-N-acetylglucosaminyltransferase that plays a key role in the synthesis of lacto- or neolacto-series carbohydrate chains on glycolipids, notably by participating in biosynthesis of HNK-1 and Lewis X carbohydrate structures. Has strong activity toward lactosylceramide (LacCer) and neolactotetraosylceramide (nLc(4)Cer; paragloboside), resulting in the synthesis of Lc(3)Cer and neolactopentaosylceramide (nLc(5)Cer), respectively. Plays a central role in regulating neolacto-series glycolipid synthesis during embryonic development (By similarity) |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 31 family |
| Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012887 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 281306748 | RefSeq | NP_446384 | 377 | lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase |
Identical Sequences to LMP012887 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:281306748 | GenBank | EDL77982.1 | 377 | rCG36757 [Rattus norvegicus] |
| GI:281306748 | RefSeq | XP_008767071.1 | 377 | PREDICTED: lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase isoform X1 [Rattus norvegicus] |
| GI:281306748 | SwissProt | Q99NB2.2 | 377 | RecName: Full=Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase; AltName: Full=Lactotriaosylceramide synthase; Short=Lc(3)Cer synthase; Short=Lc3 synthase; AltName: Full=UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5; Short=BGnT-5; Short=Beta-1,3-Gn-T5; Short=Beta-1,3-N-acetylglucosaminyltransferase 5; Short=Beta3Gn-T5 [Rattus norvegicus] |
Related Sequences to LMP012887 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:281306748 | GenBank | EDL77982.1 | 377 | rCG36757 [Rattus norvegicus] |
| GI:281306748 | RefSeq | XP_008767071.1 | 377 | PREDICTED: lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase isoform X1 [Rattus norvegicus] |
| GI:281306748 | SwissProt | Q99NB2.2 | 377 | RecName: Full=Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase; AltName: Full=Lactotriaosylceramide synthase; Short=Lc(3)Cer synthase; Short=Lc3 synthase; AltName: Full=UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5; Short=BGnT-5; Short=Beta-1,3-Gn-T5; Short=Beta-1,3-N-acetylglucosaminyltransferase 5; Short=Beta3Gn-T5 [Rattus norvegicus] |