Gene/Proteome Database (LMPD)
LMPD ID
LMP012891
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 3
Gene Symbol
Alternate Names
testosterone 17-beta-dehydrogenase 3; 17beta-HSD; 17-beta-HSD 3; estradiol 17 beta-dehydrogenase 3; 17-beta-hydroxysteroid dehydrogenase type 3; testicular 17-beta-hydroxysteroid dehydrogenase;
Chromosome
17
Map Location
17p14
EC Number
1.1.1.64
Summary
catalyzes the final step of testosterone biosynthesis in the testis [RGD, Feb 2006]
Orthologs
Proteins
testosterone 17-beta-dehydrogenase 3 | |
---|---|
Refseq ID | NP_446459 |
Protein GI | 16758926 |
UniProt ID | O54939 |
mRNA ID | NM_054007 |
Length | 306 |
MEQFLLSVGLLVCLVCLVKCVRFSRYLFLSFCKALPGSFLRSMGQWAVITGAGDGIGKAYSFELARHGLNVVLISRTLEKLQVISEEIERTTGSRVKVVQADFTREDIYDHIEEQLKGLEIGVLVNNVGMLPNLLPSHFLSTSGESQSVIHCNITSVVKMTQLVLKHMESRRRGLILNISSGVGVRPWPLYSLYSASKAFVCTFSKALNVEYRDKGIIIQVLTPYSVSTPMTKYLNTSRVTKTADEFVKESLKYVTIGAETCGCLAHEILAIILNLIPSRIFYSSTTQRFLLKQFSDYLKSNISNR |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 3
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0043231 | IDA:RGD | C | intracellular membrane-bounded organelle |
GO:0004303 | IDA:RGD | F | estradiol 17-beta-dehydrogenase activity |
GO:0047045 | IEA:UniProtKB-EC | F | testosterone 17-beta-dehydrogenase (NADP+) activity |
GO:0047035 | IDA:RGD | F | testosterone dehydrogenase (NAD+) activity |
GO:0018879 | IEP:RGD | P | biphenyl metabolic process |
GO:0071236 | IEP:RGD | P | cellular response to antibiotic |
GO:0071371 | IEP:RGD | P | cellular response to gonadotropin stimulus |
GO:0032870 | IEP:RGD | P | cellular response to hormone stimulus |
GO:0021766 | IEP:RGD | P | hippocampus development |
GO:0017143 | IEP:RGD | P | insecticide metabolic process |
GO:0033327 | IEP:RGD | P | Leydig cell differentiation |
GO:0006082 | IEP:RGD | P | organic acid metabolic process |
GO:0018958 | IEP:RGD | P | phenol-containing compound metabolic process |
GO:0014823 | IEP:RGD | P | response to activity |
GO:0046685 | IEP:RGD | P | response to arsenic-containing substance |
GO:0046686 | IEP:RGD | P | response to cadmium ion |
GO:0051412 | IEP:RGD | P | response to corticosterone |
GO:0043627 | IEP:RGD | P | response to estrogen |
GO:0045471 | IEP:RGD | P | response to ethanol |
GO:0070542 | IEP:RGD | P | response to fatty acid |
GO:0060992 | IEP:RGD | P | response to fungicide |
GO:0009635 | IEP:RGD | P | response to herbicide |
GO:0017085 | IEP:RGD | P | response to insecticide |
GO:0033591 | IEP:RGD | P | response to L-ascorbic acid |
GO:0010288 | IEP:RGD | P | response to lead ion |
GO:0010038 | IEP:RGD | P | response to metal ion |
GO:0031667 | IEP:RGD | P | response to nutrient levels |
GO:0014070 | IEP:RGD | P | response to organic cyclic compound |
GO:0048545 | IEP:RGD | P | response to steroid hormone |
GO:0033197 | IEP:RGD | P | response to vitamin E |
GO:0006694 | IDA:RGD | P | steroid biosynthetic process |
GO:0061370 | IEA:UniProtKB-UniPathway | P | testosterone biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 3
Protein Entry
DHB3_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Testosterone + NADP(+) = androst-4-ene-3,17- dione + NADPH. |
Function | Favors the reduction of androstenedione to testosterone. Uses NADPH while the two other EDH17B enzymes use NADH (By similarity) |
Pathway | Hormone biosynthesis; testosterone biosynthesis. |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily |
Identical and Related Proteins
Unique RefSeq proteins for LMP012891 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16758926 | RefSeq | NP_446459 | 306 | testosterone 17-beta-dehydrogenase 3 |
Identical Sequences to LMP012891 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16758926 | GenBank | AAB99739.1 | 306 | testicular 17-beta-hydroxysteroid dehydrogenase [Rattus norvegicus] |
GI:16758926 | SwissProt | O54939.1 | 306 | RecName: Full=Testosterone 17-beta-dehydrogenase 3; AltName: Full=17-beta-hydroxysteroid dehydrogenase type 3; Short=17-beta-HSD 3; AltName: Full=Testicular 17-beta-hydroxysteroid dehydrogenase [Rattus norvegicus] |
Related Sequences to LMP012891 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16758926 | GenBank | AAB99739.1 | 306 | testicular 17-beta-hydroxysteroid dehydrogenase [Rattus norvegicus] |
GI:16758926 | GenBank | AAI65962.1 | 305 | Hydroxysteroid (17-beta) dehydrogenase 3 [synthetic construct] |
GI:16758926 | SwissProt | O54939.1 | 306 | RecName: Full=Testosterone 17-beta-dehydrogenase 3; AltName: Full=17-beta-hydroxysteroid dehydrogenase type 3; Short=17-beta-HSD 3; AltName: Full=Testicular 17-beta-hydroxysteroid dehydrogenase [Rattus norvegicus] |