Gene/Proteome Database (LMPD)

LMPD ID
LMP012891
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 3
Gene Symbol
Alternate Names
testosterone 17-beta-dehydrogenase 3; 17beta-HSD; 17-beta-HSD 3; estradiol 17 beta-dehydrogenase 3; 17-beta-hydroxysteroid dehydrogenase type 3; testicular 17-beta-hydroxysteroid dehydrogenase;
Chromosome
17
Map Location
17p14
EC Number
1.1.1.64
Summary
catalyzes the final step of testosterone biosynthesis in the testis [RGD, Feb 2006]
Orthologs

Proteins

testosterone 17-beta-dehydrogenase 3
Refseq ID NP_446459
Protein GI 16758926
UniProt ID O54939
mRNA ID NM_054007
Length 306
MEQFLLSVGLLVCLVCLVKCVRFSRYLFLSFCKALPGSFLRSMGQWAVITGAGDGIGKAYSFELARHGLNVVLISRTLEKLQVISEEIERTTGSRVKVVQADFTREDIYDHIEEQLKGLEIGVLVNNVGMLPNLLPSHFLSTSGESQSVIHCNITSVVKMTQLVLKHMESRRRGLILNISSGVGVRPWPLYSLYSASKAFVCTFSKALNVEYRDKGIIIQVLTPYSVSTPMTKYLNTSRVTKTADEFVKESLKYVTIGAETCGCLAHEILAIILNLIPSRIFYSSTTQRFLLKQFSDYLKSNISNR

Gene Information

Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 3
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043231 IDA:RGD C intracellular membrane-bounded organelle
GO:0004303 IDA:RGD F estradiol 17-beta-dehydrogenase activity
GO:0047045 IEA:UniProtKB-EC F testosterone 17-beta-dehydrogenase (NADP+) activity
GO:0047035 IDA:RGD F testosterone dehydrogenase (NAD+) activity
GO:0033327 IEP:RGD P Leydig cell differentiation
GO:0018879 IEP:RGD P biphenyl metabolic process
GO:0071236 IEP:RGD P cellular response to antibiotic
GO:0071371 IEP:RGD P cellular response to gonadotropin stimulus
GO:0032870 IEP:RGD P cellular response to hormone stimulus
GO:0021766 IEP:RGD P hippocampus development
GO:0017143 IEP:RGD P insecticide metabolic process
GO:0006082 IEP:RGD P organic acid metabolic process
GO:0018958 IEP:RGD P phenol-containing compound metabolic process
GO:0033591 IEP:RGD P response to L-ascorbic acid
GO:0014823 IEP:RGD P response to activity
GO:0046685 IEP:RGD P response to arsenic-containing substance
GO:0046686 IEP:RGD P response to cadmium ion
GO:0051412 IEP:RGD P response to corticosterone
GO:0043627 IEP:RGD P response to estrogen
GO:0045471 IEP:RGD P response to ethanol
GO:0070542 IEP:RGD P response to fatty acid
GO:0060992 IEP:RGD P response to fungicide
GO:0009635 IEP:RGD P response to herbicide
GO:0017085 IEP:RGD P response to insecticide
GO:0010288 IEP:RGD P response to lead ion
GO:0010038 IEP:RGD P response to metal ion
GO:0031667 IEP:RGD P response to nutrient levels
GO:0014070 IEP:RGD P response to organic cyclic compound
GO:0048545 IEP:RGD P response to steroid hormone
GO:0033197 IEP:RGD P response to vitamin E
GO:0006694 IDA:RGD P steroid biosynthetic process
GO:0061370 IEA:UniProtKB-UniPathway P testosterone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 3
Protein Entry
DHB3_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Testosterone + NADP(+) = androst-4-ene-3,17- dione + NADPH.
Function Favors the reduction of androstenedione to testosterone. Uses NADPH while the two other EDH17B enzymes use NADH (By similarity)
Pathway Hormone biosynthesis; testosterone biosynthesis.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily

Identical and Related Proteins

Unique RefSeq proteins for LMP012891 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758926 RefSeq NP_446459 306 testosterone 17-beta-dehydrogenase 3

Identical Sequences to LMP012891 proteins

Reference Database Accession Length Protein Name
GI:16758926 GenBank AAB99739.1 306 testicular 17-beta-hydroxysteroid dehydrogenase [Rattus norvegicus]
GI:16758926 SwissProt O54939.1 306 RecName: Full=Testosterone 17-beta-dehydrogenase 3; AltName: Full=17-beta-hydroxysteroid dehydrogenase type 3; Short=17-beta-HSD 3; AltName: Full=Testicular 17-beta-hydroxysteroid dehydrogenase [Rattus norvegicus]

Related Sequences to LMP012891 proteins

Reference Database Accession Length Protein Name
GI:16758926 GenBank AAB99739.1 306 testicular 17-beta-hydroxysteroid dehydrogenase [Rattus norvegicus]
GI:16758926 GenBank AAI65962.1 305 Hydroxysteroid (17-beta) dehydrogenase 3 [synthetic construct]
GI:16758926 SwissProt O54939.1 306 RecName: Full=Testosterone 17-beta-dehydrogenase 3; AltName: Full=17-beta-hydroxysteroid dehydrogenase type 3; Short=17-beta-HSD 3; AltName: Full=Testicular 17-beta-hydroxysteroid dehydrogenase [Rattus norvegicus]