Gene/Proteome Database (LMPD)

LMPD ID
LMP012896
Gene ID
117514
Species
Rattus norvegicus (Rat)
Gene Name
thioredoxin interacting protein
Gene Symbol
Txnip
Synonyms
Vdup1;
Alternate Names
thioredoxin-interacting protein; vitamin D3 up-regulated protein 1; upregulated by 1,25-dihydroxyvitamin D-3;
Chromosome
2
Map Location
2q34
Summary
regulates thioredoxin to play an important role in the preservation of cellular viability [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Txnip

Proteins

thioredoxin-interacting protein
Refseq ID NP_001008767
Protein GI 56912221
UniProt ID Q5M7W1
mRNA ID NM_001008767
Length 394
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVTVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTLDYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWIDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDVDDSQDSPIFMYAPEFQFMPPPTYTEVDPCVLNNNNNNVQ

Gene Information

Entrez Gene ID
117514
Gene Name
thioredoxin interacting protein
Gene Symbol
Txnip
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0005758 IDA:RGD C mitochondrial intermembrane space
GO:0005634 IDA:RGD C nucleus
GO:0004857 IEA:Ensembl F enzyme inhibitor activity
GO:0007049 IEA:UniProtKB-KW P cell cycle
GO:0071228 ISS:UniProtKB P cellular response to tumor cell
GO:0030216 IEA:Ensembl P keratinocyte differentiation
GO:0051782 ISS:UniProtKB P negative regulation of cell division
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0048008 IEA:Ensembl P platelet-derived growth factor receptor signaling pathway
GO:0043065 IMP:RGD P positive regulation of apoptotic process
GO:0006606 IEA:Ensembl P protein import into nucleus
GO:0042127 IDA:RGD P regulation of cell proliferation
GO:0051592 IEP:RGD P response to calcium ion
GO:0042493 IEP:RGD P response to drug
GO:0032355 IEP:RGD P response to estradiol
GO:0009749 IEP:RGD P response to glucose
GO:0042542 IEP:RGD P response to hydrogen peroxide
GO:0009612 IEP:RGD P response to mechanical stimulus
GO:0032570 IEP:RGD P response to progesterone
GO:0006351 IEA:UniProtKB-KW P transcription, DNA-templated

REACTOME Pathway Links

REACTOME Pathway ID Description
5953410 Immune System
5954349 Inflammasomes
5953409 Innate Immune System
5953796 Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways
5954353 The NLRP3 inflammasome

Domain Information

InterPro Annotations

Accession Description
IPR011022 Arrestin C-terminal-like domain
IPR011021 Arrestin-like, N-terminal
IPR014756 Immunoglobulin E-set

UniProt Annotations

Entry Information

Gene Name
thioredoxin interacting protein
Protein Entry
TXNIP_RAT
UniProt ID
Q5M7W1
Species
Rat

Comments

Comment Type Description
Function May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Inhibits the proteasomal degradation of DDIT4, and thereby contributes to the inhibition of the mammalian target of rapamycin complex 1 (mTORC1) (By similarity). Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. Required for the maturation of natural killer cells. Acts as a suppressor of tumor cell growth (By similarity)
Ptm Ubiquitinated; undergoes polyubiquitination catalyzed by ITCH resulting in proteasomal degradation
Similarity Belongs to the arrestin family
Subcellular Location Cytoplasm .
Subunit Homodimer; disulfide-linked. Interacts with TXN/thioredoxin through its redox-active site. Interacts with transcriptional repressors ZBTB16, ZBTB32 and HDAC1 (By similarity). Interacts (via C-terminus) with ITCH (via WW domains). Interacts with DDIT4 (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012896 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
56912221 RefSeq NP_001008767 394 thioredoxin-interacting protein

Identical Sequences to LMP012896 proteins

Reference Database Accession Length Protein Name
GI:56912221 GenBank AAH88411.1 394 Thioredoxin interacting protein [Rattus norvegicus]
GI:56912221 GenBank EDL85625.1 394 upregulated by 1,25-dihydroxyvitamin D-3 [Rattus norvegicus]
GI:56912221 SwissProt Q5M7W1.1 394 RecName: Full=Thioredoxin-interacting protein; AltName: Full=Vitamin D3 up-regulated protein 1 [Rattus norvegicus]

Related Sequences to LMP012896 proteins

Reference Database Accession Length Protein Name
GI:56912221 GenBank AAH88411.1 394 Thioredoxin interacting protein [Rattus norvegicus]
GI:56912221 GenBank EDL85625.1 394 upregulated by 1,25-dihydroxyvitamin D-3 [Rattus norvegicus]
GI:56912221 SwissProt Q5M7W1.1 394 RecName: Full=Thioredoxin-interacting protein; AltName: Full=Vitamin D3 up-regulated protein 1 [Rattus norvegicus]