Gene/Proteome Database (LMPD)

LMPD ID
LMP012898
Gene ID
117523
Species
Rattus norvegicus (Rat)
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Gene Symbol
St8sia2
Synonyms
Siat8b;
Alternate Names
alpha-2,8-sialyltransferase 8B; STX; SIAT8-B; ST8SiaII; ST8Sia II; sialyltransferase X; sialyltransferase 8B; sialytransferase St8Sia II; sialyltransferase St8Sia II; sialyltransferase 8 (alpha-2 8-sialytransferase) B; sialyltransferase 8 (alpha-2, 8-sialytransferase) B; sialyltransferase 8 (alpha-2, 8-sialyltransferase) B;
Chromosome
1
Map Location
1q31
EC Number
2.4.99.-
Summary
human homolog catalyzes the polysialylation of the neural cell adhesion molecule NCAM and may play a role in neurogenesis [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for St8sia2

Proteins

alpha-2,8-sialyltransferase 8B precursor
Refseq ID NP_476497
Protein GI 16924022
UniProt ID Q07977
mRNA ID NM_057156
Length 375
MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSLPAVADRSNESLKHSIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2712 peptide sequence: MQLQFRSWMLAALTLLVVFLIFA

Gene Information

Entrez Gene ID
117523
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Gene Symbol
St8sia2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005769 IEA:Ensembl C early endosome
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0055037 IEA:Ensembl C recycling endosome
GO:0003828 IEA:Ensembl F alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity
GO:0008373 TAS:RGD F sialyltransferase activity
GO:0006491 IEA:Ensembl P N-glycan processing
GO:0001574 IEA:Ensembl P ganglioside biosynthetic process
GO:0097503 TAS:GOC P sialylation

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953532 Axon guidance
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5953533 Developmental Biology
5953345 Metabolism of proteins
5954395 N-Glycan antennae elongation
5954394 N-glycan antennae elongation in the medial/trans-Golgi
5953531 NCAM signaling for neurite out-growth
5954138 NCAM1 interactions
5953728 Post-translational protein modification
5954270 Sialic acid metabolism
5953737 Synthesis of substrates in N-glycan biosythesis
5954050 Transport to the Golgi and subsequent modification

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Protein Entry
SIA8B_RAT
UniProt ID
Q07977
Species
Rat

Comments

Comment Type Description
Developmental Stage Newborn.
Function May transfer sialic acid through alpha-2,8-linkages to the alpha-2,3-linked and alpha-2,6-linked sialic acid of N-linked oligosaccharides of glycoproteins and may be involved in PSA (polysialic acid) expression.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 29 family
Subcellular Location Golgi apparatus membrane ; Single-pass type II membrane protein .
Tissue Specificity Expressed only in newborn brain.

Identical and Related Proteins

Unique RefSeq proteins for LMP012898 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16924022 RefSeq NP_476497 375 alpha-2,8-sialyltransferase 8B precursor

Identical Sequences to LMP012898 proteins

Reference Database Accession Length Protein Name
GI:16924022 GenBank AAA42147.1 375 developmentally regulated member of sialyltransferase gene family [Rattus norvegicus]
GI:16924022 GenBank AFG79829.1 375 Sequence 88 from patent US 8137928
GI:16924022 SwissProt Q07977.1 375 RecName: Full=Alpha-2,8-sialyltransferase 8B; AltName: Full=Sialyltransferase 8B; Short=SIAT8-B; AltName: Full=Sialyltransferase St8Sia II; Short=ST8SiaII; AltName: Full=Sialyltransferase X; Short=STX [Rattus norvegicus]

Related Sequences to LMP012898 proteins

Reference Database Accession Length Protein Name
GI:16924022 GenBank AAA42147.1 375 developmentally regulated member of sialyltransferase gene family [Rattus norvegicus]
GI:16924022 GenBank AFG79829.1 375 Sequence 88 from patent US 8137928
GI:16924022 SwissProt Q07977.1 375 RecName: Full=Alpha-2,8-sialyltransferase 8B; AltName: Full=Sialyltransferase 8B; Short=SIAT8-B; AltName: Full=Sialyltransferase St8Sia II; Short=ST8SiaII; AltName: Full=Sialyltransferase X; Short=STX [Rattus norvegicus]