Gene/Proteome Database (LMPD)
LMPD ID
LMP012899
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phospholipid scramblase 1
Gene Symbol
Alternate Names
phospholipid scramblase 1; PL scramblase 1; phospholipid scramblase 2; ca(2+)-dependent phospholipid scramblase 1;
Chromosome
8
Map Location
8q31
Summary
may act as a downstream mediator of immune response in IgE receptor signaling; may transport phospholipids in the plasma membrane [RGD, Feb 2006]
Orthologs
Proteins
| phospholipid scramblase 1 | |
|---|---|
| Refseq ID | NP_476542 |
| Protein GI | 17105346 |
| UniProt ID | P58195 |
| mRNA ID | NM_057194 |
| Length | 335 |
| MEKHGPPEHAAYPIPQADYQGSQGPYPGPQGPYPGPQGPYAGPQGPYPGPQGPYAGPQGPYPGPQPGYPVPPGSYAGGDPSGFPVQHQPAYNHPGGPGGTPWMQAPPPPLDCPPGLEYLTQIDQILVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGVW | |
Gene Information
Entrez Gene ID
Gene Name
phospholipid scramblase 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | ISS:UniProtKB | C | Golgi apparatus |
| GO:0005829 | ISS:UniProtKB | C | cytosol |
| GO:0031012 | ISS:UniProtKB | C | extracellular matrix |
| GO:0005887 | ISS:UniProtKB | C | integral component of plasma membrane |
| GO:0045121 | IDA:UniProtKB | C | membrane raft |
| GO:0005730 | ISS:UniProtKB | C | nucleolus |
| GO:0005886 | IDA:UniProtKB | C | plasma membrane |
| GO:0042609 | ISS:UniProtKB | F | CD4 receptor binding |
| GO:0003677 | IEA:UniProtKB-KW | F | DNA binding |
| GO:0001077 | ISS:UniProtKB | F | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription |
| GO:0017124 | ISS:UniProtKB | F | SH3 domain binding |
| GO:0005509 | ISS:UniProtKB | F | calcium ion binding |
| GO:0019899 | IPI:UniProtKB | F | enzyme binding |
| GO:0005154 | ISS:UniProtKB | F | epidermal growth factor receptor binding |
| GO:0017128 | ISS:UniProtKB | F | phospholipid scramblase activity |
| GO:0006915 | ISS:UniProtKB | P | apoptotic process |
| GO:0051607 | ISS:UniProtKB | P | defense response to virus |
| GO:0006955 | IMP:RGD | P | immune response |
| GO:0045071 | ISS:UniProtKB | P | negative regulation of viral genome replication |
| GO:0017121 | IMP:UniProtKB | P | phospholipid scrambling |
| GO:0015914 | TAS:RGD | P | phospholipid transport |
| GO:2000373 | ISS:UniProtKB | P | positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity |
| GO:0045089 | ISS:UniProtKB | P | positive regulation of innate immune response |
| GO:0045944 | ISS:UniProtKB | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0060368 | IMP:UniProtKB | P | regulation of Fc receptor mediated stimulatory signaling pathway |
| GO:0033003 | IMP:UniProtKB | P | regulation of mast cell activation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005552 | Scramblase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ; |
| Domain | The N-terminal proline-rich domain (PRD) is required for phospholipid scramblase activity |
| Function | May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. |
| Function | May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes. May contribute to cytokine-regulated cell proliferation and differentiation (By similarity) |
| Ptm | Phosphorylated on tyrosine residues |
| Similarity | Belongs to the phospholipid scramblase family |
| Subcellular Location | Membrane ; Single-pass type II membrane protein. Membrane; Lipid-anchor ; Cytoplasmic side. Nucleus . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012899 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 17105346 | RefSeq | NP_476542 | 335 | phospholipid scramblase 1 |
Identical Sequences to LMP012899 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17105346 | GenBank | AAK00575.1 | 335 | phospholipid scramblase PLSCR [Rattus norvegicus] |
| GI:17105346 | GenBank | EDL77538.1 | 335 | rCG25825, isoform CRA_a [Rattus norvegicus] |
| GI:17105346 | RefSeq | XP_006243600.1 | 335 | PREDICTED: phospholipid scramblase 1 isoform X1 [Rattus norvegicus] |
| GI:17105346 | SwissProt | P58195.1 | 335 | RecName: Full=Phospholipid scramblase 1; Short=PL scramblase 1; AltName: Full=Ca(2+)-dependent phospholipid scramblase 1 [Rattus norvegicus] |
Related Sequences to LMP012899 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17105346 | GenBank | AAK00575.1 | 335 | phospholipid scramblase PLSCR [Rattus norvegicus] |
| GI:17105346 | GenBank | EDL77538.1 | 335 | rCG25825, isoform CRA_a [Rattus norvegicus] |
| GI:17105346 | SwissProt | P58195.1 | 335 | RecName: Full=Phospholipid scramblase 1; Short=PL scramblase 1; AltName: Full=Ca(2+)-dependent phospholipid scramblase 1 [Rattus norvegicus] |