Gene/Proteome Database (LMPD)

LMPD ID
LMP012899
Gene ID
117540
Species
Rattus norvegicus (Rat)
Gene Name
phospholipid scramblase 1
Gene Symbol
Plscr1
Alternate Names
phospholipid scramblase 1; PL scramblase 1; phospholipid scramblase 2; ca(2+)-dependent phospholipid scramblase 1;
Chromosome
8
Map Location
8q31
Summary
may act as a downstream mediator of immune response in IgE receptor signaling; may transport phospholipids in the plasma membrane [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Plscr1

Proteins

phospholipid scramblase 1
Refseq ID NP_476542
Protein GI 17105346
UniProt ID P58195
mRNA ID NM_057194
Length 335
MEKHGPPEHAAYPIPQADYQGSQGPYPGPQGPYPGPQGPYAGPQGPYPGPQGPYAGPQGPYPGPQPGYPVPPGSYAGGDPSGFPVQHQPAYNHPGGPGGTPWMQAPPPPLDCPPGLEYLTQIDQILVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGVW

Gene Information

Entrez Gene ID
117540
Gene Name
phospholipid scramblase 1
Gene Symbol
Plscr1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 ISS:UniProtKB C cytosol
GO:0031012 ISS:UniProtKB C extracellular matrix
GO:0005794 ISS:UniProtKB C Golgi apparatus
GO:0005887 ISS:UniProtKB C integral component of plasma membrane
GO:0045121 IDA:UniProtKB C membrane raft
GO:0005730 ISS:UniProtKB C nucleolus
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0005509 ISS:UniProtKB F calcium ion binding
GO:0042609 ISS:UniProtKB F CD4 receptor binding
GO:0003677 IEA:UniProtKB-KW F DNA binding
GO:0019899 IPI:UniProtKB F enzyme binding
GO:0005154 ISS:UniProtKB F epidermal growth factor receptor binding
GO:0017128 ISS:UniProtKB F phospholipid scramblase activity
GO:0001077 ISS:UniProtKB F RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0017124 ISS:UniProtKB F SH3 domain binding
GO:0006915 ISS:UniProtKB P apoptotic process
GO:0051607 ISS:UniProtKB P defense response to virus
GO:0006955 IMP:RGD P immune response
GO:0045071 ISS:UniProtKB P negative regulation of viral genome replication
GO:0017121 IMP:UniProtKB P phospholipid scrambling
GO:0015914 TAS:RGD P phospholipid transport
GO:2000373 ISS:UniProtKB P positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity
GO:0045089 ISS:UniProtKB P positive regulation of innate immune response
GO:0045944 ISS:UniProtKB P positive regulation of transcription from RNA polymerase II promoter
GO:0060368 IMP:UniProtKB P regulation of Fc receptor mediated stimulatory signaling pathway
GO:0033003 IMP:UniProtKB P regulation of mast cell activation

Domain Information

InterPro Annotations

Accession Description
IPR005552 Scramblase

UniProt Annotations

Entry Information

Gene Name
phospholipid scramblase 1
Protein Entry
PLS1_RAT
UniProt ID
P58195
Species
Rat

Comments

Comment Type Description
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ;
Domain The N-terminal proline-rich domain (PRD) is required for phospholipid scramblase activity
Function May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
Function May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes. May contribute to cytokine-regulated cell proliferation and differentiation (By similarity)
Ptm Phosphorylated on tyrosine residues
Similarity Belongs to the phospholipid scramblase family
Subcellular Location Membrane ; Single-pass type II membrane protein. Membrane; Lipid-anchor ; Cytoplasmic side. Nucleus .

Identical and Related Proteins

Unique RefSeq proteins for LMP012899 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17105346 RefSeq NP_476542 335 phospholipid scramblase 1

Identical Sequences to LMP012899 proteins

Reference Database Accession Length Protein Name
GI:17105346 GenBank AAK00575.1 335 phospholipid scramblase PLSCR [Rattus norvegicus]
GI:17105346 GenBank EDL77538.1 335 rCG25825, isoform CRA_a [Rattus norvegicus]
GI:17105346 RefSeq XP_006243600.1 335 PREDICTED: phospholipid scramblase 1 isoform X1 [Rattus norvegicus]
GI:17105346 SwissProt P58195.1 335 RecName: Full=Phospholipid scramblase 1; Short=PL scramblase 1; AltName: Full=Ca(2+)-dependent phospholipid scramblase 1 [Rattus norvegicus]

Related Sequences to LMP012899 proteins

Reference Database Accession Length Protein Name
GI:17105346 GenBank AAK00575.1 335 phospholipid scramblase PLSCR [Rattus norvegicus]
GI:17105346 GenBank EDL77538.1 335 rCG25825, isoform CRA_a [Rattus norvegicus]
GI:17105346 SwissProt P58195.1 335 RecName: Full=Phospholipid scramblase 1; Short=PL scramblase 1; AltName: Full=Ca(2+)-dependent phospholipid scramblase 1 [Rattus norvegicus]