Gene/Proteome Database (LMPD)

LMPD ID
LMP012940
Gene ID
171155
Species
Rattus norvegicus (Rat)
Gene Name
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
Gene Symbol
Hadhb
Alternate Names
trifunctional enzyme subunit beta, mitochondrial; TP-beta; mitochondrial trifunctional protein, beta subunit; hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit;
Chromosome
6
Map Location
6q14
EC Number
2.3.1.16
Summary
a subunit of a multienzyme complex that is involved in mitochondrial fatty acid oxidation [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Hadhb

Proteins

trifunctional enzyme subunit beta, mitochondrial precursor
Refseq ID NP_598302
Protein GI 19424338
UniProt ID Q60587
mRNA ID NM_133618
Length 475
MTTILTSTFRNLSTTSKWALRFSVRPLSCSSQVQSAPAVQTKSKKTLAKPNLKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLYRTNIPKDVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSDVPIRHSRNMRKMMLDLNKAKTLAQRLSLLTKFRLNFLSPELPAVAEFSTNETMGHSADRLAAAFAVSRMEQDKYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVSKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGRKTKVGAPPLEKFNIWGGSLSLGHPFGATGCRLVMAAANRLRKDGGQYALVAACAAGGQGHAMIVEAYPK
sig_peptide: 1..34 experiment: experimental evidence, no additional details recorded calculated_mol_wt: 3848 peptide sequence: MTTILTSTFRNLSTTSKWALRFSVRPLSCSSQVQ transit_peptide: 1..34 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (Q60587.1) calculated_mol_wt: 3848 peptide sequence: MTTILTSTFRNLSTTSKWALRFSVRPLSCSSQVQ mat_peptide: 35..475 product: trifunctional enzyme subunit beta, mitochondrial EC_number: 2.3.1.16 experiment: experimental evidence, no additional details recorded calculated_mol_wt: 47584 peptide sequence: SAPAVQTKSKKTLAKPNLKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLYRTNIPKDVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSDVPIRHSRNMRKMMLDLNKAKTLAQRLSLLTKFRLNFLSPELPAVAEFSTNETMGHSADRLAAAFAVSRMEQDKYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVSKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGRKTKVGAPPLEKFNIWGGSLSLGHPFGATGCRLVMAAANRLRKDGGQYALVAACAAGGQGHAMIVEAYPK

Gene Information

Entrez Gene ID
171155
Gene Name
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
Gene Symbol
Hadhb
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016507 IDA:RGD C mitochondrial fatty acid beta-oxidation multienzyme complex
GO:0005743 ISS:UniProtKB C mitochondrial inner membrane
GO:0042645 IEA:Ensembl C mitochondrial nucleoid
GO:0005741 ISS:UniProtKB C mitochondrial outer membrane
GO:0005739 IDA:RGD C mitochondrion
GO:0003857 IDA:RGD F 3-hydroxyacyl-CoA dehydrogenase activity
GO:0003988 IDA:RGD F acetyl-CoA C-acyltransferase activity
GO:0004300 IDA:RGD F enoyl-CoA hydratase activity
GO:0000062 IDA:RGD F fatty-acyl-CoA binding
GO:0016509 IDA:RGD F long-chain-3-hydroxyacyl-CoA dehydrogenase activity
GO:0016508 IDA:RGD F long-chain-enoyl-CoA hydratase activity
GO:0051287 IDA:RGD F NAD binding
GO:0044822 IEA:Ensembl F poly(A) RNA binding
GO:0032403 IMP:RGD F protein complex binding
GO:0006635 IDA:RGD P fatty acid beta-oxidation

KEGG Pathway Links

KEGG Pathway ID Description
M00087 beta-Oxidation
M00085 Fatty acid biosynthesis, elongation, mitochondria
ko00071 Fatty acid degradation
rno00071 Fatty acid degradation
ko00062 Fatty acid elongation
rno00062 Fatty acid elongation
ko01212 Fatty acid metabolism
rno01212 Fatty acid metabolism
rno01100 Metabolic pathways
ko00280 Valine, leucine and isoleucine degradation
rno00280 Valine, leucine and isoleucine degradation

REACTOME Pathway Links

REACTOME Pathway ID Description
5954472 Acyl chain remodeling of CL
5953503 Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA
5953501 Beta oxidation of hexanoyl-CoA to butanoyl-CoA
5953496 Beta oxidation of lauroyl-CoA to decanoyl-CoA-CoA
5953498 Beta oxidation of myristoyl-CoA to lauroyl-CoA
5953502 Beta oxidation of octanoyl-CoA to hexanoyl-CoA
5953499 Beta oxidation of palmitoyl-CoA to myristoyl-CoA
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953473 Glycerophospholipid biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953287 Mitochondrial Fatty Acid Beta-Oxidation
5953497 mitochondrial fatty acid beta-oxidation of saturated fatty acids
5953474 Phospholipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR002155 Thiolase
IPR020610 Thiolase, active site
IPR020615 Thiolase, acyl-enzyme intermediate active site
IPR020613 Thiolase, conserved site
IPR020617 Thiolase, C-terminal
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup
IPR020616 Thiolase, N-terminal

UniProt Annotations

Entry Information

Gene Name
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
Protein Entry
ECHB_RAT
UniProt ID
Q60587
Species
Rat

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + acetyl-CoA = CoA + 3-oxoacyl-CoA.
Pathway Lipid metabolism; fatty acid beta-oxidation.
Similarity Belongs to the thiolase family
Subcellular Location Mitochondrion . Mitochondrion inner membrane . Mitochondrion outer membrane {ECO:0000250}. Endoplasmic reticulum .
Subunit Octamer of 4 alpha (HADHA) and 4 beta (HADHB) subunits. Interacts with RSAD2/viperin (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012940 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
19424338 RefSeq NP_598302 475 trifunctional enzyme subunit beta, mitochondrial precursor

Identical Sequences to LMP012940 proteins

Reference Database Accession Length Protein Name
GI:19424338 GenBank EDM02997.1 475 hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, isoform CRA_b [Rattus norvegicus]
GI:19424338 GenBank EDM02998.1 475 hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, isoform CRA_b [Rattus norvegicus]
GI:19424338 RefSeq XP_006239850.1 475 PREDICTED: trifunctional enzyme subunit beta, mitochondrial isoform X1 [Rattus norvegicus]
GI:19424338 RefSeq XP_006239851.1 475 PREDICTED: trifunctional enzyme subunit beta, mitochondrial isoform X1 [Rattus norvegicus]

Related Sequences to LMP012940 proteins

Reference Database Accession Length Protein Name
GI:19424338 GenBank AAH60545.1 475 Hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit [Rattus norvegicus]
GI:19424338 GenBank EDM02997.1 475 hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, isoform CRA_b [Rattus norvegicus]
GI:19424338 GenBank EDM02998.1 475 hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, isoform CRA_b [Rattus norvegicus]
GI:19424338 SwissProt Q60587.1 475 RecName: Full=Trifunctional enzyme subunit beta, mitochondrial; AltName: Full=TP-beta; Includes: RecName: Full=3-ketoacyl-CoA thiolase; AltName: Full=Acetyl-CoA acyltransferase; AltName: Full=Beta-ketothiolase; Flags: Precursor [Rattus norvegicus]