Gene/Proteome Database (LMPD)
LMPD ID
LMP012948
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
inositol polyphosphate multikinase
Gene Symbol
Synonyms
Impk; Ipk2;
Alternate Names
inositol polyphosphate multikinase; inositol polyphosphate kinase 2; inositol 1,3,4,6-tetrakisphosphate 5-kinase;
Chromosome
20
Map Location
20p11
EC Number
2.7.1.151
Summary
involved in the synthesis of inositol 1,4,5-trisphosphate and an inositol pyrophosphate [RGD, Feb 2006]
Orthologs
Proteins
| inositol polyphosphate multikinase | |
|---|---|
| Refseq ID | NP_599244 |
| Protein GI | 19705555 |
| UniProt ID | Q99NI4 |
| mRNA ID | NM_134417 |
| Length | 396 |
| MAAEPPALRLRPPGSTGDSPPVPRLLGGCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQLQPPPRGPRELEFYTMVYAADCADAVLLELRKHLPKYYGVWSPPSAPNDVYLKLEDVTHKFNKPCIMDVKIGRKSYDPFASAEKIQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQHYGRGLTKETLKEGVSKFFHNGFCLRKDAVAASIQKVEKILQWFENQKQLNFYASSLLFVYEGSSQPATTKSNDRTLAGRFLSKGALSDADVLECNNNFHLFSSPANGTSVGKSLSKAYSRHRKLYAKKHQSQTSLKVETLEQDNGWKSMSQEHLNGNVLSQLEKVFYHLPAGRQEIAEAEVRMIDFAHVFPSNTVDEGYVYGLKHLIAVLRSILDS | |
Gene Information
Entrez Gene ID
Gene Name
inositol polyphosphate multikinase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0000824 | IEA:Ensembl | F | inositol tetrakisphosphate 3-kinase activity |
| GO:0008440 | IEA:Ensembl | F | inositol-1,4,5-trisphosphate 3-kinase activity |
| GO:0000823 | IEA:UniProtKB-EC | F | inositol-1,4,5-trisphosphate 6-kinase activity |
| GO:0032958 | IEA:Ensembl | P | inositol phosphate biosynthetic process |
| GO:0001841 | IEA:Ensembl | P | neural tube formation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00562 | Inositol phosphate metabolism |
| rno00562 | Inositol phosphate metabolism |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005522 | Inositol polyphosphate kinase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2 ATP + 1D-myo-inositol 1,4,5-trisphosphate = 2 ADP + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate. |
| Function | Inositol phosphate kinase with a broad substrate specificity. Has a preference for inositol 1,4,5-trisphosphate (Ins(1,4,5)P3) and inositol 1,3,4,6-tetrakisphosphate (Ins(1,3,4,6)P4) (By similarity) |
| Similarity | Belongs to the inositol phosphokinase (IPK) family |
| Subcellular Location | Nucleus . |
| Tissue Specificity | Highly expressed in kidney, and at lower levels in hippocampus, brain cortex, cerebellum, heart and lung |
Identical and Related Proteins
Unique RefSeq proteins for LMP012948 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 19705555 | RefSeq | NP_599244 | 396 | inositol polyphosphate multikinase |
Identical Sequences to LMP012948 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19705555 | GenBank | AAG42923.1 | 396 | inositol polyphosphate multikinase [Rattus norvegicus] |
| GI:19705555 | GenBank | EDL97252.1 | 396 | rCG60966, isoform CRA_b [Rattus norvegicus] |
| GI:19705555 | SwissProt | Q99NI4.1 | 396 | RecName: Full=Inositol polyphosphate multikinase; AltName: Full=Inositol 1,3,4,6-tetrakisphosphate 5-kinase [Rattus norvegicus] |
Related Sequences to LMP012948 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19705555 | GenBank | AAG42923.1 | 396 | inositol polyphosphate multikinase [Rattus norvegicus] |
| GI:19705555 | GenBank | EDL97252.1 | 396 | rCG60966, isoform CRA_b [Rattus norvegicus] |
| GI:19705555 | RefSeq | XP_006256407.1 | 397 | PREDICTED: inositol polyphosphate multikinase isoform X1 [Rattus norvegicus] |
| GI:19705555 | SwissProt | Q99NI4.1 | 396 | RecName: Full=Inositol polyphosphate multikinase; AltName: Full=Inositol 1,3,4,6-tetrakisphosphate 5-kinase [Rattus norvegicus] |