Gene/Proteome Database (LMPD)

LMPD ID
LMP012954
Gene ID
192155
Species
Rattus norvegicus (Rat)
Gene Name
surfactant protein B
Gene Symbol
Sftpb
Synonyms
Sp-b;
Alternate Names
pulmonary surfactant-associated protein B; surfactant associated protein B; surfactant pulmonary-associated protein B; surfactant, pulmonary-associated protein B; pulmonary surfactant-associated proteolipid SPL(Phe);
Chromosome
4
Map Location
4q33
Summary
acts to lower surface tension in lung alveoli [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Sftpb

Proteins

pulmonary surfactant-associated protein B precursor
Refseq ID NP_620197
Protein GI 20301980
UniProt ID P22355
mRNA ID NM_138842
Length 376
MAKLHLQWLLLLPTLCSLGAATESASSPDCAQGPKFWCQSLEQAIQCRALGHCLQEVWGHAGANDLCQECEDIVHLLTKMTKEDAFQDTIRKFLEQECDILPLKLLVPRCRQVLDVYLPLVIDYFQGQIKPKAICSHVGLCPLGQTKPEQKPEMLDAIPNPLLNKLVLPALPGAFLARPGPHTQDLSEQQLPIPLPFCWLCRTLIKRVQAVIPKGVLAVAVSQVCHVVPLVVGGICQCLAERYTVLLLDALLGRVVPQLVCGLVLRCSTADAIGPALPALEPLIEKWPLQDTECHFCKSVINQAWNTSEQAMPQAMHQACLRFWLDRQKCEQFVEQHMPQLLALVPRSQDAHTSCQALGVCEAPASPLQCFQTPHL
sig_peptide: 1..24 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (P22355.1) calculated_mol_wt: 2610 peptide sequence: MAKLHLQWLLLLPTLCSLGAATES mat_peptide: 191..269 product: pulmonary surfactant-associated protein B calculated_mol_wt: 8506 peptide sequence: LPIPLPFCWLCRTLIKRVQAVIPKGVLAVAVSQVCHVVPLVVGGICQCLAERYTVLLLDALLGRVVPQLVCGLVLRCST

Gene Information

Entrez Gene ID
192155
Gene Name
surfactant protein B
Gene Symbol
Sftpb
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0097208 IDA:RGD C alveolar lamellar body
GO:0005615 IDA:RGD C extracellular space
GO:0005764 IEA:InterPro C lysosome
GO:0005771 IDA:RGD C multivesicular body
GO:0071260 IEP:RGD P cellular response to mechanical stimulus
GO:0071732 IEP:RGD P cellular response to nitric oxide
GO:0007623 IEP:RGD P circadian rhythm
GO:0050828 TAS:RGD P regulation of liquid surface tension
GO:0007585 IEA:UniProtKB-KW P respiratory gaseous exchange
GO:0070849 IEP:RGD P response to epidermal growth factor
GO:0051384 IEP:RGD P response to glucocorticoid
GO:0009749 IEP:RGD P response to glucose
GO:0070848 IEP:RGD P response to growth factor
GO:0055093 IEP:RGD P response to hyperoxia
GO:0001666 IEP:RGD P response to hypoxia
GO:0070741 IEP:RGD P response to interleukin-6
GO:0032496 IEP:RGD P response to lipopolysaccharide
GO:0033189 IEP:RGD P response to vitamin A
GO:0006665 IEA:InterPro P sphingolipid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR008373 Saposin
IPR008139 Saposin B
IPR003119 Saposin type A
IPR011001 Saposin-like
IPR007856 Saposin-like type B, 1
IPR008138 Saposin-like type B, 2

UniProt Annotations

Entry Information

Gene Name
surfactant protein B
Protein Entry
PSPB_RAT
UniProt ID
P22355
Species
Rat

Comments

Comment Type Description
Function Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air- liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Miscellaneous Pulmonary surfactant consists of 90% lipid and 10% protein. There are 4 surfactant-associated proteins: 2 collagenous, carbohydrate-binding glycoproteins (SP-A and SP-D) and 2 small hydrophobic proteins (SP-B and SP-C).
Similarity Contains 1 saposin A-type domain
Similarity Contains 3 saposin B-type domains
Subcellular Location Secreted, extracellular space, surface film.
Subunit Homodimer; disulfide-linked.

Identical and Related Proteins

Unique RefSeq proteins for LMP012954 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20301980 RefSeq NP_620197 376 pulmonary surfactant-associated protein B precursor

Identical Sequences to LMP012954 proteins

Reference Database Accession Length Protein Name
GI:20301980 EMBL CAA32885.1 376 pulmonary surfactant-associated protein SP-B, precursor [Rattus norvegicus]
GI:20301980 SwissProt P22355.1 376 RecName: Full=Pulmonary surfactant-associated protein B; Short=SP-B; AltName: Full=Pulmonary surfactant-associated proteolipid SPL(Phe); Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012954 proteins

Reference Database Accession Length Protein Name
GI:20301980 EMBL CAA32885.1 376 pulmonary surfactant-associated protein SP-B, precursor [Rattus norvegicus]
GI:20301980 GenBank AAH72466.1 376 Surfactant protein B [Rattus norvegicus]
GI:20301980 GenBank EDL91019.1 376 surfactant associated protein B [Rattus norvegicus]
GI:20301980 SwissProt P22355.1 376 RecName: Full=Pulmonary surfactant-associated protein B; Short=SP-B; AltName: Full=Pulmonary surfactant-associated proteolipid SPL(Phe); Flags: Precursor [Rattus norvegicus]