Gene/Proteome Database (LMPD)
LMPD ID
LMP012962
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class L
Gene Symbol
Alternate Names
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; PIG-L; phosphatidylinositol glycan, class L; phosphatidylinositol-glycan biosynthesis class L protein;
Chromosome
10
Map Location
10q23
EC Number
3.5.1.89
Summary
catalyzes the N-deacetylation of N-acetyl-D-glucosaminylphosphatidylinositol in the second step of GPI anchor biosynthesis [RGD, Feb 2006]
Orthologs
Proteins
| N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase | |
|---|---|
| Refseq ID | NP_620256 |
| Protein GI | 20302097 |
| UniProt ID | O35790 |
| mRNA ID | NM_138901 |
| Length | 252 |
| MEVVGLLCVAVAVLTWGFLRVWNSAERMRSPEQAGLPGAGSRALVVIAHPDDEAMFFAPTILGLARLKQQVSLLCFSSGNYYNQGEIRKKELLQSCAVLGIPPSRVMIIDKREFPDDPEVQWDTEHVASTILQHIHANATDLVVTFDAEGVSGHSNHIALYKAVRALHSGGKLPEGCSVLTLQSVNVLRKYVFLLDLPWTLLSPQGVLFVLTSKEVAQAKKAMSCHRSQLLWFRHLYTVFSRYMSVNSLQLL | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class L
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0042406 | TAS:RGD | C | extrinsic component of endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0000225 | IMP:RGD | F | N-acetylglucosaminylphosphatidylinositol deacetylase activity |
| GO:0006506 | IMP:RGD | P | GPI anchor biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00065 | GPI-anchor biosynthesis, core oligosaccharide |
| ko00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| rno00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class L
Protein Entry
PIGL_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol + H(2)O = 6-(alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol + acetate. |
| Function | Involved in the second step of GPI biosynthesis. De-N- acetylation of N-acetylglucosaminyl-phosphatidylinositol |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Similarity | Belongs to the PIGL family |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP012962 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 20302097 | RefSeq | NP_620256 | 252 | N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase |
Identical Sequences to LMP012962 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20302097 | DBBJ | BAA20869.1 | 252 | PIG-L [Rattus norvegicus] |
| GI:20302097 | GenBank | AAH74020.1 | 252 | Pigl protein [Rattus norvegicus] |
| GI:20302097 | GenBank | EDM04707.1 | 252 | phosphatidylinositol glycan, class L [Rattus norvegicus] |
| GI:20302097 | SwissProt | O35790.1 | 252 | RecName: Full=N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; AltName: Full=Phosphatidylinositol-glycan biosynthesis class L protein; Short=PIG-L [Rattus norvegicus] |
Related Sequences to LMP012962 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20302097 | DBBJ | BAA20869.1 | 252 | PIG-L [Rattus norvegicus] |
| GI:20302097 | GenBank | AAH74020.1 | 252 | Pigl protein [Rattus norvegicus] |
| GI:20302097 | GenBank | EDM04707.1 | 252 | phosphatidylinositol glycan, class L [Rattus norvegicus] |
| GI:20302097 | SwissProt | O35790.1 | 252 | RecName: Full=N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; AltName: Full=Phosphatidylinositol-glycan biosynthesis class L protein; Short=PIG-L [Rattus norvegicus] |