Gene/Proteome Database (LMPD)

LMPD ID
LMP012963
Gene ID
192270
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidic acid phosphatase type 2B
Gene Symbol
Ppap2b
Synonyms
Dri42;
Alternate Names
lipid phosphate phosphohydrolase 3; PAP2b; PAP-2b; PAP2-beta; ER transmembrane protein Dri 42; phosphatidic acid phosphatase 2b; phosphatidate phosphohydrolase type 2b; differentially expressed in rat intestine 42;
Chromosome
5
Map Location
5q34
Summary
an endoplasmic reticulum resident protein; upregulated during epithelial differentiation [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Ppap2b

Proteins

lipid phosphate phosphohydrolase 3
Refseq ID NP_620260
Protein GI 48675867
UniProt ID Q6IMX4
mRNA ID NM_138905
Length 312
MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRREILSPVDIMDRSNHHNMV

Gene Information

Entrez Gene ID
192270
Gene Name
phosphatidic acid phosphatase type 2B
Gene Symbol
Ppap2b
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005886 IEA:Ensembl C plasma membrane
GO:0042577 IEA:Ensembl F lipid phosphatase activity
GO:0042392 IEA:Ensembl F sphingosine-1-phosphate phosphatase activity
GO:0060020 IEA:Ensembl P Bergmann glial cell differentiation
GO:0001568 IEA:Ensembl P blood vessel development
GO:0044329 IEA:Ensembl P canonical Wnt signaling pathway involved in positive regulation of cell-cell adhesion
GO:0044328 IEA:Ensembl P canonical Wnt signaling pathway involved in positive regulation of endothelial cell migration
GO:0044330 IEA:Ensembl P canonical Wnt signaling pathway involved in positive regulation of wound healing
GO:0001702 IEA:Ensembl P gastrulation with mouth forming second
GO:0034109 IEA:Ensembl P homotypic cell-cell adhesion
GO:0001933 IEA:Ensembl P negative regulation of protein phosphorylation
GO:0006644 IEA:Ensembl P phospholipid metabolic process
GO:0050731 IEA:Ensembl P positive regulation of peptidyl-tyrosine phosphorylation
GO:0051091 IEA:Ensembl P positive regulation of sequence-specific DNA binding transcription factor activity
GO:0050821 IEA:Ensembl P protein stabilization
GO:0030111 IEA:Ensembl P regulation of Wnt signaling pathway
GO:1902068 IEA:Ensembl P regulation of sphingolipid mediated signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
ko00565 Ether lipid metabolism
rno00565 Ether lipid metabolism
ko04975 Fat digestion and absorption
rno04975 Fat digestion and absorption
ko04666 Fc gamma R-mediated phagocytosis
rno04666 Fc gamma R-mediated phagocytosis
ko00561 Glycerolipid metabolism
rno00561 Glycerolipid metabolism
ko00564 Glycerophospholipid metabolism
rno00564 Glycerophospholipid metabolism
rno01100 Metabolic pathways
ko00600 Sphingolipid metabolism
rno00600 Sphingolipid metabolism
M00089 Triacylglycerol biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954266 Sphingolipid de novo biosynthesis
5954267 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR028675 Lipid phosphate phosphohydrolase 3
IPR000326 Phosphatidic acid phosphatase type 2/haloperoxidase

UniProt Annotations

Entry Information

Gene Name
phosphatidic acid phosphatase type 2B
Protein Entry
Q6IMX4_RAT
UniProt ID
Q6IMX4
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP012963 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
48675867 RefSeq NP_620260 312 lipid phosphate phosphohydrolase 3

Identical Sequences to LMP012963 proteins

Reference Database Accession Length Protein Name
GI:48675867 GenBank AAH72544.1 312 Phosphatidic acid phosphatase type 2B [Rattus norvegicus]
GI:48675867 GenBank EDL97885.1 312 phosphatidic acid phosphatase type 2B, isoform CRA_b [Rattus norvegicus]

Related Sequences to LMP012963 proteins

Reference Database Accession Length Protein Name
GI:48675867 EMBL CAA69106.1 312 ER transmembrane protein [Rattus norvegicus]
GI:48675867 GenBank AAH72544.1 312 Phosphatidic acid phosphatase type 2B [Rattus norvegicus]
GI:48675867 GenBank EDL97885.1 312 phosphatidic acid phosphatase type 2B, isoform CRA_b [Rattus norvegicus]
GI:48675867 SwissProt P97544.1 312 RecName: Full=Lipid phosphate phosphohydrolase 3; AltName: Full=Differentially expressed in rat intestine 42; Short=Dri42; AltName: Full=PAP2-beta; AltName: Full=Phosphatidate phosphohydrolase type 2b; AltName: Full=Phosphatidic acid phosphatase 2b; Short=PAP-2b; Short=PAP2b [Rattus norvegicus]