Gene/Proteome Database (LMPD)

LMPD ID
LMP013003
Gene ID
286964
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 6
Gene Symbol
Hsd17b6
Synonyms
Hsd17b9;
Alternate Names
17-beta-hydroxysteroid dehydrogenase type 6; 17-beta-HSD6; 17-beta-HSD 6; 3-alpha->beta-HSE; 3-alpha->beta-hydroxysteroid epimerase; hydroxysteroid (17-beta) dehydrogenase 9; oxidative 3-alpha hydroxysteroid dehydrogenase; oxidative 17 beta hydroxysteroid dehydrogenase type 6;
Chromosome
7
Map Location
7q11
EC Number
1.1.1.105
Summary
catalyzes the oxidation of 3alpha-adiol to androsterone in androgen metabolism [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Hsd17b6

Proteins

17-beta-hydroxysteroid dehydrogenase type 6
Refseq ID NP_775427
Protein GI 27545384
UniProt ID O54753
mRNA ID NM_173305
Length 327
MITAPGHSLIMWFYLVTLVGLYYLLRWYRERQVVSHLHDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELKSKTSDRLETVILDVTNTDSISAATQWVKEHVGDKGLWGLVNNAGVFQAFAYIEWCRPEDCMSIFQVNLIGLAQVTLSMLFLVKKARGRIVNVSSVLGRVALFGGFYSCSKYGVEAFSDVLRREIRDFGVKVSIIEPGSFKTRMTDAELSIEKTKKTWEATPEHIRESYGQQFFDDFCNTTRRELKKCSTNLSLVTDCMEHALTSKYPRTRYSAGWDARLFFIPLSYLPTSLVDCLLAISRRKPAQAV

Gene Information

Entrez Gene ID
286964
Gene Name
hydroxysteroid (17-beta) dehydrogenase 6
Gene Symbol
Hsd17b6
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0004303 IEA:UniProtKB-EC F estradiol 17-beta-dehydrogenase activity
GO:0004745 IEA:UniProtKB-EC F retinol dehydrogenase activity
GO:0047035 TAS:RGD F testosterone dehydrogenase (NAD+) activity
GO:0008209 TAS:RGD P androgen metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00830 Retinol metabolism
rno00830 Retinol metabolism
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 6
Protein Entry
H17B6_RAT
UniProt ID
O54753
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=0.1 uM for 5-alpha-androstan-3-alpha,17-beta-diol ; KM=0.2 uM for androsterone ; KM=0.5 uM for dihydrotestosterone ; KM=1.1 uM for testosterone ; KM=0.8 uM for estradiol ; KM=3 uM for NAD ; KM=1 mM for NADP ; Vmax=2.5 nmol/min/mg enzyme for 5-alpha-androstan-3-alpha,17- beta-diol ; Vmax=0.1 nmol/min/mg enzyme for androsterone ; Vmax=0.5 nmol/min/mg enzyme for dihydrotestosterone ; Vmax=1.1 nmol/min/mg enzyme for testosterone ; Vmax=2.1 nmol/min/mg enzyme for estradiol ; Note=Vmax was measured using transfected cell lysates.;
Catalytic Activity 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H.
Catalytic Activity All-trans-retinol-[cellular-retinol-binding- protein] + NAD(+) = all-trans-retinal-[cellular-retinol-binding- protein] + NADH.
Catalytic Activity Testosterone + NAD(+) = androstenedione + NADH.
Enzyme Regulation Competitively inhibited by 9-cis-retinoic ancid and 13-cis-retinoic acid
Function NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has retinol dehydrogenase activity towards all-trans- retinol (in vitro) (By similarity). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3-alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro)
Induction Up-regulated by testosterone. Levels are very low in castrated male rats
Sequence Caution Sequence=AAB88253.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH88104.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH91114.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family
Subcellular Location Microsome membrane ; Peripheral membrane protein {ECO:0000250}; Lumenal side . Endoplasmic reticulum membrane ; Peripheral membrane protein {ECO:0000250}; Lumenal side .
Tissue Specificity Detected in prostate, liver and kidney

Identical and Related Proteins

Unique RefSeq proteins for LMP013003 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
27545384 RefSeq NP_775427 327 17-beta-hydroxysteroid dehydrogenase type 6

Identical Sequences to LMP013003 proteins

Reference Database Accession Length Protein Name
GI:27545384 GenBank AAB88253.1 327 oxidative 17 beta hydroxysteroid dehydrogenase type 6 [Rattus norvegicus]

Related Sequences to LMP013003 proteins

Reference Database Accession Length Protein Name
GI:27545384 GenBank AAB88253.1 327 oxidative 17 beta hydroxysteroid dehydrogenase type 6 [Rattus norvegicus]
GI:27545384 GenBank AAH88104.1 327 Hydroxysteroid (17-beta) dehydrogenase 6 [Rattus norvegicus]
GI:27545384 GenBank AAH91114.1 327 Hydroxysteroid (17-beta) dehydrogenase 6 [Rattus norvegicus]
GI:27545384 RefSeq XP_008768115.1 317 PREDICTED: 17-beta-hydroxysteroid dehydrogenase type 6 [Rattus norvegicus]