Gene/Proteome Database (LMPD)
LMPD ID
LMP013018
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Gene Symbol
Synonyms
Siat7A;
Alternate Names
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1; alpha-2,6-sialyltransferase ST6GalNAc I; sialyltransferase 7 ((alpha-N-acetylneuraminyl 2,3-beta-galactosyl-1,3)-N-acetyl galactosaminde alpha-2,6-sialyltransferase) A;
Chromosome
10
Map Location
10q32.3
Proteins
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 precursor | |
---|---|
Refseq ID | NP_001099329 |
Protein GI | 157786730 |
UniProt ID | G3V9C4 |
mRNA ID | NM_001105859 |
Length | 520 |
MENRCRGLSQGQTFLLLTGLMLLFILPSVVKEPSTRVSRYQFIEDNESSLQGVPQKPAPQGPIVTLTPTVHNKKTTSVRTKWVELQKQDRATARGERGEGVEKKLQAIRLAPENPKGKAEPEVKTPASKHLDKLPRATGALSTRKTQMATGAAPAKKKVVQPTPTPASFPHLTTQRRQRLKASDFKSEPRWDFEEEYSLDGGSLQTTCPGSVKITASHSPWLQNIFLPNITLFLDSGRFNQSEWYRLEHFTPPFGFMELNQSLVQKVVSRFPPVPQQQLLLASLPTRNLTCITCAVVGNGGILNNSRMGQEIDSHDYVFRLSGAVIKGYEQDVGTRTSFYGFTAFSLVQSILNLGRQGFQHVPLGKDVRYLHFLEGTRDYEWLEAMFLNRTMANTKLYWFRHRPQEAFREALDLDRYFLVHPDFLRYMKNRFLRSKTLDTAHWRLYRPTTGALLLLTALHLCDKVSAYGFITQGHERFSDHYYDTSWKRLIFYINHDFALERTVWKRLHDEGIIQLYQRP | |
sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3479 peptide sequence: MENRCRGLSQGQTFLLLTGLMLLFILPSVVK |
Gene Information
Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0001665 | IEA:Ensembl | F | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity |
GO:0009312 | IEA:Ensembl | P | oligosaccharide biosynthetic process |
GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
rno01100 | Metabolic pathways |
ko00512 | Mucin type O-Glycan biosynthesis |
rno00512 | Mucin type O-Glycan biosynthesis |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953739 | Asparagine N-linked glycosylation |
5953738 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
5953345 | Metabolism of proteins |
5953728 | Post-translational protein modification |
5954270 | Sialic acid metabolism |
5953737 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001675 | Glycosyl transferase, family 29 |
UniProt Annotations
Entry Information
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Protein Entry
G3V9C4_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013018 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157786730 | RefSeq | NP_001099329 | 520 | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 precursor |
Identical Sequences to LMP013018 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157786730 | GenBank | EDM06692.1 | 520 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 [Rattus norvegicus] |
Related Sequences to LMP013018 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157786730 | EMBL | CAG25684.1 | 519 | alpha-2,6-sialyltransferase ST6GalNAc I, partial [Rattus norvegicus] |
GI:157786730 | GenBank | EDM06692.1 | 520 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 [Rattus norvegicus] |
GI:157786730 | GenBank | AFG79807.1 | 519 | Sequence 66 from patent US 8137928 |
GI:157786730 | GenBank | AFN90540.1 | 519 | Sequence 63 from patent US 8198045 |