Gene/Proteome Database (LMPD)

LMPD ID
LMP013018
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Gene Symbol
Synonyms
Siat7A;
Alternate Names
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1; alpha-2,6-sialyltransferase ST6GalNAc I; sialyltransferase 7 ((alpha-N-acetylneuraminyl 2,3-beta-galactosyl-1,3)-N-acetyl galactosaminde alpha-2,6-sialyltransferase) A;
Chromosome
10
Map Location
10q32.3

Proteins

alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 precursor
Refseq ID NP_001099329
Protein GI 157786730
UniProt ID G3V9C4
mRNA ID NM_001105859
Length 520
MENRCRGLSQGQTFLLLTGLMLLFILPSVVKEPSTRVSRYQFIEDNESSLQGVPQKPAPQGPIVTLTPTVHNKKTTSVRTKWVELQKQDRATARGERGEGVEKKLQAIRLAPENPKGKAEPEVKTPASKHLDKLPRATGALSTRKTQMATGAAPAKKKVVQPTPTPASFPHLTTQRRQRLKASDFKSEPRWDFEEEYSLDGGSLQTTCPGSVKITASHSPWLQNIFLPNITLFLDSGRFNQSEWYRLEHFTPPFGFMELNQSLVQKVVSRFPPVPQQQLLLASLPTRNLTCITCAVVGNGGILNNSRMGQEIDSHDYVFRLSGAVIKGYEQDVGTRTSFYGFTAFSLVQSILNLGRQGFQHVPLGKDVRYLHFLEGTRDYEWLEAMFLNRTMANTKLYWFRHRPQEAFREALDLDRYFLVHPDFLRYMKNRFLRSKTLDTAHWRLYRPTTGALLLLTALHLCDKVSAYGFITQGHERFSDHYYDTSWKRLIFYINHDFALERTVWKRLHDEGIIQLYQRP
sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3479 peptide sequence: MENRCRGLSQGQTFLLLTGLMLLFILPSVVK

Gene Information

Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0001665 IEA:Ensembl F alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity
GO:0009312 IEA:Ensembl P oligosaccharide biosynthetic process
GO:0006486 IEA:InterPro P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00512 Mucin type O-Glycan biosynthesis
rno00512 Mucin type O-Glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5953345 Metabolism of proteins
5953728 Post-translational protein modification
5954270 Sialic acid metabolism
5953737 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29

UniProt Annotations

Entry Information

Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Protein Entry
G3V9C4_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013018 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157786730 RefSeq NP_001099329 520 alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 precursor

Identical Sequences to LMP013018 proteins

Reference Database Accession Length Protein Name
GI:157786730 GenBank EDM06692.1 520 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 [Rattus norvegicus]

Related Sequences to LMP013018 proteins

Reference Database Accession Length Protein Name
GI:157786730 EMBL CAG25684.1 519 alpha-2,6-sialyltransferase ST6GalNAc I, partial [Rattus norvegicus]
GI:157786730 GenBank EDM06692.1 520 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 [Rattus norvegicus]
GI:157786730 GenBank AFG79807.1 519 Sequence 66 from patent US 8137928
GI:157786730 GenBank AFN90540.1 519 Sequence 63 from patent US 8198045