Gene/Proteome Database (LMPD)
LMPD ID
LMP013030
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
insulin induced gene 2
Gene Symbol
Alternate Names
insulin-induced gene 2 protein; INSIG-2;
Chromosome
13
Map Location
13q11
Summary
endoplasmic reticulum protein that blocks proteolytic activation of sterol regulatory element-binding proteins [RGD, Feb 2006]
Orthologs
Proteins
insulin-induced gene 2 protein | |
---|---|
Refseq ID | NP_835192 |
Protein GI | 30017409 |
UniProt ID | Q80UA9 |
mRNA ID | NM_178091 |
Length | 225 |
MAEGETESPRPKKRGPYISSVTSQSVNVVIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVITSIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNFQFSLTLAALSVGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:RGD | C | endoplasmic reticulum |
GO:0032937 | IEA:Ensembl | C | SREBP-SCAP-Insig complex |
GO:0008134 | IDA:RGD | F | transcription factor binding |
GO:0006695 | IEA:Ensembl | P | cholesterol biosynthetic process |
GO:0060363 | IEA:Ensembl | P | cranial suture morphogenesis |
GO:0042472 | IEA:Ensembl | P | inner ear morphogenesis |
GO:0042474 | IEA:Ensembl | P | middle ear morphogenesis |
GO:0045717 | IEA:Ensembl | P | negative regulation of fatty acid biosynthetic process |
GO:0010894 | IEA:Ensembl | P | negative regulation of steroid biosynthetic process |
GO:0060021 | IEA:Ensembl | P | palate development |
GO:0070542 | IEP:RGD | P | response to fatty acid |
GO:0032868 | IEP:RGD | P | response to insulin |
GO:0033993 | IEP:RGD | P | response to lipid |
GO:0032933 | IEA:Ensembl | P | SREBP signaling pathway |
GO:0006641 | IEA:Ensembl | P | triglyceride metabolic process |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR025929 | Insulin-induced protein family |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. Functions by blocking the processing of sterol regulatory element-binding proteins (SREBPs). Capable of retaining the SCAP-SREBF2 complex in the ER thus preventing it from escorting SREBPs to the Golgi. Seems to regulate the ubiquitin-mediated proteasomal degradation of HMGCR (By similarity) |
Similarity | Belongs to the INSIG family |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein . |
Subunit | Binds to the SCAP-SREBF2 complex only in the presence of sterols. Interacts with RNF139 (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP013030 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
30017409 | RefSeq | NP_835192 | 225 | insulin-induced gene 2 protein |
Identical Sequences to LMP013030 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30017409 | RefSeq | XP_006249729.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus] |
GI:30017409 | RefSeq | XP_006249730.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus] |
GI:30017409 | RefSeq | XP_006249731.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus] |
GI:30017409 | SwissProt | Q80UA9.1 | 225 | RecName: Full=Insulin-induced gene 2 protein; Short=INSIG-2 [Rattus norvegicus] |
Related Sequences to LMP013030 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30017409 | GenBank | AAN78347.1 | 225 | INSIG2 membrane protein [Rattus norvegicus] |
GI:30017409 | RefSeq | XP_006249730.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus] |
GI:30017409 | RefSeq | XP_006249731.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus] |
GI:30017409 | SwissProt | Q80UA9.1 | 225 | RecName: Full=Insulin-induced gene 2 protein; Short=INSIG-2 [Rattus norvegicus] |