Gene/Proteome Database (LMPD)

LMPD ID
LMP013030
Gene ID
288985
Species
Rattus norvegicus (Rat)
Gene Name
insulin induced gene 2
Gene Symbol
Insig2
Alternate Names
insulin-induced gene 2 protein; INSIG-2;
Chromosome
13
Map Location
13q11
Summary
endoplasmic reticulum protein that blocks proteolytic activation of sterol regulatory element-binding proteins [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Insig2

Proteins

insulin-induced gene 2 protein
Refseq ID NP_835192
Protein GI 30017409
UniProt ID Q80UA9
mRNA ID NM_178091
Length 225
MAEGETESPRPKKRGPYISSVTSQSVNVVIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVITSIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNFQFSLTLAALSVGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE

Gene Information

Entrez Gene ID
288985
Gene Name
insulin induced gene 2
Gene Symbol
Insig2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0032937 IEA:Ensembl C SREBP-SCAP-Insig complex
GO:0005783 IDA:RGD C endoplasmic reticulum
GO:0008134 IDA:RGD F transcription factor binding
GO:0032933 IEA:Ensembl P SREBP signaling pathway
GO:0006695 IEA:Ensembl P cholesterol biosynthetic process
GO:0060363 IEA:Ensembl P cranial suture morphogenesis
GO:0042472 IEA:Ensembl P inner ear morphogenesis
GO:0042474 IEA:Ensembl P middle ear morphogenesis
GO:0045717 IEA:Ensembl P negative regulation of fatty acid biosynthetic process
GO:0010894 IEA:Ensembl P negative regulation of steroid biosynthetic process
GO:0060021 IEA:Ensembl P palate development
GO:0070542 IEP:RGD P response to fatty acid
GO:0032868 IEP:RGD P response to insulin
GO:0033993 IEP:RGD P response to lipid
GO:0006641 IEA:Ensembl P triglyceride metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954497 Regulation of cholesterol biosynthesis by SREBP (SREBF)

Domain Information

InterPro Annotations

Accession Description
IPR025929 Insulin-induced protein family

UniProt Annotations

Entry Information

Gene Name
insulin induced gene 2
Protein Entry
INSI2_RAT
UniProt ID
Q80UA9
Species
Rat

Comments

Comment Type Description
Function Mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. Functions by blocking the processing of sterol regulatory element-binding proteins (SREBPs). Capable of retaining the SCAP-SREBF2 complex in the ER thus preventing it from escorting SREBPs to the Golgi. Seems to regulate the ubiquitin-mediated proteasomal degradation of HMGCR (By similarity)
Similarity Belongs to the INSIG family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .
Subunit Binds to the SCAP-SREBF2 complex only in the presence of sterols. Interacts with RNF139 (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP013030 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30017409 RefSeq NP_835192 225 insulin-induced gene 2 protein

Identical Sequences to LMP013030 proteins

Reference Database Accession Length Protein Name
GI:30017409 RefSeq XP_006249729.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus]
GI:30017409 RefSeq XP_006249730.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus]
GI:30017409 RefSeq XP_006249731.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus]
GI:30017409 SwissProt Q80UA9.1 225 RecName: Full=Insulin-induced gene 2 protein; Short=INSIG-2 [Rattus norvegicus]

Related Sequences to LMP013030 proteins

Reference Database Accession Length Protein Name
GI:30017409 GenBank AAN78347.1 225 INSIG2 membrane protein [Rattus norvegicus]
GI:30017409 RefSeq XP_006249730.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus]
GI:30017409 RefSeq XP_006249731.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Rattus norvegicus]
GI:30017409 SwissProt Q80UA9.1 225 RecName: Full=Insulin-induced gene 2 protein; Short=INSIG-2 [Rattus norvegicus]