Gene/Proteome Database (LMPD)
Proteins
| lysophospholipase-like protein 1 | |
|---|---|
| Refseq ID | NP_001099456 |
| Protein GI | 157787089 |
| UniProt ID | D3ZFS7 |
| mRNA ID | NM_001105986 |
| Length | 138 |
| MCQVLTGLIDDEVKNGIEKSRILIGGFSMGGCMAMHLAYRKHPGVAGVFVLSGFLNKASAVYQDLQQGGRAFPELFQCHGTADDLVLHAWGEETNSNLKSLGVSTTFHSLPDVYHELSRPELERLNCHEAARRDRWAE | |
Gene Information
Entrez Gene ID
Gene Name
lysophospholipase-like 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016787 | IEA:InterPro | F | hydrolase activity |
| GO:0042997 | IEA:Ensembl | P | negative regulation of Golgi to plasma membrane protein transport |
| GO:0002084 | IEA:Ensembl | P | protein depalmitoylation |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013037 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157787089 | RefSeq | NP_001099456 | 138 | lysophospholipase-like protein 1 |
Identical Sequences to LMP013037 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157787089 | GenBank | EDL94927.1 | 138 | lysophospholipase-like 1 (predicted), isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP013037 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157787089 | GenBank | AAH27340.1 | 239 | Lysophospholipase-like 1 [Mus musculus] |
| GI:157787089 | GenBank | EDL13063.1 | 239 | lysophospholipase-like 1, isoform CRA_b [Mus musculus] |
| GI:157787089 | GenBank | EDL94927.1 | 138 | lysophospholipase-like 1 (predicted), isoform CRA_a [Rattus norvegicus] |
| GI:157787089 | GenBank | EDL94928.1 | 110 | lysophospholipase-like 1 (predicted), isoform CRA_b [Rattus norvegicus] |