Gene/Proteome Database (LMPD)
Proteins
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 precursor | |
---|---|
Refseq ID | NP_001099538 |
Protein GI | 157823527 |
UniProt ID | D3ZX31 |
mRNA ID | NM_001106068 |
Length | 378 |
MRLPRLRPVVSLLLALAALLLLLTCQSPPSCPAPESPTEPKDDPAWAPDLSRAHAAPCRANLSVSAHPAFARLPSHVRDFLLYRHCRDFAVLREPKATKCAQPAFLLLAIKSSPANYGRRQVLRTTWARERRVRGASLRRLFLVGSDRDPQQARKFNRLLELEAKAYGDILQWDFHDSFFNLTLKQVLFLEWQRTHCTNASFVLNGDDDVFAHTDNMVTYLQGRDPDQHLFVGHLIQNVGPIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFTMAALHRAARVLPIFPIDDVFLGMCLQQQGLAPGAHSGVRTAGVLPPSPRVSSFDPCFYRDLLLVHRFLPFEMLLMWDALSRPQLACGRQSPPLLTGLGGRHP | |
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2760 peptide sequence: MRLPRLRPVVSLLLALAALLLLLTC |
Gene Information
Entrez Gene ID
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008378 | IEA:InterPro | F | galactosyltransferase activity |
GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
rno00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
rno01100 | Metabolic pathways |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953253 | Disease |
5953252 | Glycogen storage diseases |
5953861 | Glycosaminoglycan metabolism |
5954344 | Keratan sulfate biosynthesis |
5954345 | Keratan sulfate/keratin metabolism |
5953250 | Metabolism |
5953249 | Metabolism of carbohydrates |
5953345 | Metabolism of proteins |
5953870 | MPS I - Hurler syndrome |
5953869 | MPS II - Hunter syndrome |
5953872 | MPS IIIA - Sanfilippo syndrome A |
5953864 | MPS IIIB - Sanfilippo syndrome B |
5953867 | MPS IIIC - Sanfilippo syndrome C |
5953871 | MPS IIID - Sanfilippo syndrome D |
5953866 | MPS IV - Morquio syndrome A |
5953873 | MPS IV - Morquio syndrome B |
5953862 | MPS IX - Natowicz syndrome |
5953868 | MPS VII - Sly syndrome |
5953865 | MPS VI - Maroteaux-Lamy syndrome |
5953863 | Mucopolysaccharidoses |
5953251 | Myoclonic epilepsy of Lafora |
5954369 | O-linked glycosylation |
5954368 | O-linked glycosylation of mucins |
5953728 | Post-translational protein modification |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002659 | Glycosyl transferase, family 31 |
UniProt Annotations
Entry Information
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
Protein Entry
D3ZX31_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013057 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157823527 | RefSeq | NP_001099538 | 378 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 precursor |
Identical Sequences to LMP013057 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157823527 | GenBank | EDL90759.1 | 378 | rCG38749 [Rattus norvegicus] |
GI:157823527 | RefSeq | XP_008769303.1 | 378 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013057 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157823527 | DBBJ | BAE25710.1 | 372 | unnamed protein product [Mus musculus] |
GI:157823527 | GenBank | AAH26418.1 | 372 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Mus musculus] |
GI:157823527 | GenBank | EDL90759.1 | 378 | rCG38749 [Rattus norvegicus] |
GI:157823527 | RefSeq | XP_008769303.1 | 378 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 isoform X1 [Rattus norvegicus] |