Gene/Proteome Database (LMPD)

LMPD ID
LMP013064
Gene ID
291075
Species
Rattus norvegicus (Rat)
Gene Name
enoyl-CoA delta isomerase 2
Gene Symbol
Eci2
Synonyms
Peci;
Alternate Names
enoyl-CoA delta isomerase 2, mitochondrial; dodecenoyl-CoA isomerase; D3,D2-enoyl-CoA isomerase; enoyl-Coenzyme A delta isomerase 2; delta(3),delta(2)-enoyl-CoA isomerase; peroxisomal D3,D2-enoyl-CoA isomerase; peroxisomal 3,2-trans-enoyl-CoA isomerase; peroxisomal delta3, delta2-enoyl-Coenzyme A isomerase;
Chromosome
17
Map Location
17p12
EC Number
5.3.3.8

Proteins

enoyl-CoA delta isomerase 2, mitochondrial
Refseq ID NP_001006967
Protein GI 55741520
UniProt ID Q5XIC0
mRNA ID NM_001006966
Length 391
MAAVTWSRARCWCPSLLQVLRLPVTKLHLGRPAMRATQQDFENAMNQVKLLKKDPGNEVKLRLYALYKQATEGPCTMPKPGVFDFVNKAKWDAWNALGSLPKETARQNYVDLVSSLSSSSEASSQGKGGADGKAQESKGILVTSEGGITKITFNRPSKKNAITFQMYQDIILALKNASTDDTVITVFTGAGDYYSSGNDLTNFTSASGGMEEAANKGAIVLREFVNTFIDFPKPLVAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTRLKTYAKLPPNSMRISKELIRKNEKEKLHAVNEEECTTLRARWLSEECINAIMSFVTRKPKL
transit_peptide: 1..36 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q5XIC0.1) calculated_mol_wt: 4090 peptide sequence: MAAVTWSRARCWCPSLLQVLRLPVTKLHLGRPAMRA mat_peptide: 37..391 product: Enoyl-CoA delta isomerase 2, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q5XIC0.1) calculated_mol_wt: 38950 peptide sequence: TQQDFENAMNQVKLLKKDPGNEVKLRLYALYKQATEGPCTMPKPGVFDFVNKAKWDAWNALGSLPKETARQNYVDLVSSLSSSSEASSQGKGGADGKAQESKGILVTSEGGITKITFNRPSKKNAITFQMYQDIILALKNASTDDTVITVFTGAGDYYSSGNDLTNFTSASGGMEEAANKGAIVLREFVNTFIDFPKPLVAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTRLKTYAKLPPNSMRISKELIRKNEKEKLHAVNEEECTTLRARWLSEECINAIMSFVTRKPKL

Gene Information

Entrez Gene ID
291075
Gene Name
enoyl-CoA delta isomerase 2
Gene Symbol
Eci2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IDA:RGD C mitochondrion
GO:0005777 IDA:RGD C peroxisome
GO:0004165 IEA:UniProtKB-EC F dodecenoyl-CoA delta-isomerase activity
GO:0000062 IEA:InterPro F fatty-acyl-CoA binding
GO:0016863 IDA:RGD F intramolecular oxidoreductase activity, transposing C=C bonds
GO:0006635 IDA:RGD P fatty acid beta-oxidation

KEGG Pathway Links

KEGG Pathway ID Description
ko00071 Fatty acid degradation
rno00071 Fatty acid degradation
ko04146 Peroxisome
rno04146 Peroxisome

Domain Information

InterPro Annotations

Accession Description
IPR000582 Acyl-CoA-binding protein, ACBP
IPR022408 Acyl-CoA-binding protein, ACBP, conserved site
IPR029045 ClpP/crotonase-like domain
IPR001753 Crotonase_core_superfam
IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle

UniProt Annotations

Entry Information

Gene Name
enoyl-CoA delta isomerase 2
Protein Entry
ECI2_RAT
UniProt ID
Q5XIC0
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=1; Comment=Additional isoforms may exist.; Name=1; IsoId=Q5XIC0-1; Sequence=Displayed;
Catalytic Activity (3Z)-dodec-3-enoyl-CoA = (2E)-dodec-2-enoyl- CoA.
Function Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species. Has a preference for 3-trans substrates
Similarity Contains 1 ACB (acyl-CoA-binding) domain
Similarity In the C-terminal section; belongs to the enoyl-CoA hydratase/isomerase family
Subcellular Location Peroxisome matrix . Mitochondrion .
Tissue Specificity Liver (at protein level)

Identical and Related Proteins

Unique RefSeq proteins for LMP013064 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
55741520 RefSeq NP_001006967 391 enoyl-CoA delta isomerase 2, mitochondrial

Identical Sequences to LMP013064 proteins

Reference Database Accession Length Protein Name
GI:55741520 GenBank AAH83764.1 391 Peroxisomal D3,D2-enoyl-CoA isomerase [Rattus norvegicus]
GI:55741520 SwissProt Q5XIC0.1 391 RecName: Full=Enoyl-CoA delta isomerase 2, mitochondrial; AltName: Full=Delta(3),delta(2)-enoyl-CoA isomerase; Short=D3,D2-enoyl-CoA isomerase; AltName: Full=Dodecenoyl-CoA isomerase; AltName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase; Short=pECI; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP013064 proteins

Reference Database Accession Length Protein Name
GI:55741520 GenBank AAH83764.1 391 Peroxisomal D3,D2-enoyl-CoA isomerase [Rattus norvegicus]
GI:55741520 GenBank EDL98295.1 358 rCG44212, isoform CRA_a [Rattus norvegicus]
GI:55741520 GenBank EDL98296.1 358 rCG44212, isoform CRA_a [Rattus norvegicus]
GI:55741520 SwissProt Q5XIC0.1 391 RecName: Full=Enoyl-CoA delta isomerase 2, mitochondrial; AltName: Full=Delta(3),delta(2)-enoyl-CoA isomerase; Short=D3,D2-enoyl-CoA isomerase; AltName: Full=Dodecenoyl-CoA isomerase; AltName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase; Short=pECI; Flags: Precursor [Rattus norvegicus]