Gene/Proteome Database (LMPD)

LMPD ID
LMP013068
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 1, member C2
Gene Symbol
Synonyms
Akr1c21;
Alternate Names
aldo-keto reductase family 1 member C21; 17-alpha-HSD; 3-alpha-hydroxysteroid dehydrogenase; 17-alpha-hydroxysteroid dehydrogenase; aldo-keto reductase family 1, member C21; 3(or 17)-alpha-hydroxysteroid dehydrogenase;
Chromosome
17
Map Location
17q12.3
EC Number
1.1.1.-

Proteins

aldo-keto reductase family 1 member C21
Refseq ID NP_001013075
Protein GI 61556820
UniProt ID Q6AYQ2
mRNA ID NM_001013057
Length 318
MNSKCHCVKLNDGHFIPVLGFGTAMPSELPKSKAKEVTKIAIDAGFHHFDSAFVYNTEDHVGEAIREKIANGTTRREDIFYTSKLWCTSLHPELVRSSLECSLKKLQLDYVDLYLIHFPMALKPGDENFPVDEHGKLLFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKYKPVCNQVECHLYLNQMKLLDFCKTNGIILVAYGVLGTQRYNGWVDQNSPVLLNEPVLSSMAKKYNQTPALIALRHQLQRGIVVLNTSLKEERIKENMKLSPEDMKVLDDLNRNLRYIAGGIFEGHPNFPFLDEY

Gene Information

Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member C2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0047023 IEA:UniProtKB-EC F androsterone dehydrogenase activity
GO:0008202 IEA:UniProtKB-KW P steroid metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953720 Bile acid and bile salt metabolism
5953253 Disease
5953382 Diseases associated with visual transduction
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954392 Retinoid metabolism and transport
5953381 Signal Transduction
5953492 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
5953930 Synthesis of bile acids and bile salts
5953933 Synthesis of bile acids and bile salts via 24-hydroxycholesterol
5953929 Synthesis of bile acids and bile salts via 27-hydroxycholesterol
5953931 Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member C2
Protein Entry
AK1CL_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Androsterone + NAD(P)(+) = 5-alpha-androstane- 3,17-dione + NAD(P)H.
Function NADP-dependent 17-alpha-hydroxysteroid dehydrogenase that converts 5-alpha-androstane-3,17-dione into androsterone. Has lower 3-alpha-hydroxysteroid dehydrogenase activity. Has broad substrate specificity and acts on various 17-alpha- hydroxysteroids, 17-ketosteroids, 3-alpha hydroxysteroids and 3- ketosteroids. Reduction of keto groups is strictly stereoselective. Reduction of 17-ketosteroids yields only 17- alpha-hydroxysteroids. Likewise, reduction of 3-ketosteroids yields only 3-alpha-hydroxysteroids (By similarity)
Similarity Belongs to the aldo/keto reductase family
Subcellular Location Cytoplasm .
Subunit Monomer

Identical and Related Proteins

Unique RefSeq proteins for LMP013068 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
61556820 RefSeq NP_001013075 318 aldo-keto reductase family 1 member C21

Identical Sequences to LMP013068 proteins

Reference Database Accession Length Protein Name
GI:61556820 GenBank AAH78957.1 318 Aldo-keto reductase family 1, member C21 [Rattus norvegicus]
GI:61556820 SwissProt Q6AYQ2.1 318 RecName: Full=Aldo-keto reductase family 1 member C21; AltName: Full=17-alpha-hydroxysteroid dehydrogenase; Short=17-alpha-HSD; AltName: Full=3(or 17)-alpha-hydroxysteroid dehydrogenase; AltName: Full=3-alpha-hydroxysteroid dehydrogenase [Rattus norvegicus]

Related Sequences to LMP013068 proteins

Reference Database Accession Length Protein Name
GI:61556820 GenBank AAH78957.1 318 Aldo-keto reductase family 1, member C21 [Rattus norvegicus]
GI:61556820 RefSeq XP_006254245.1 323 PREDICTED: aldo-keto reductase family 1 member C21 isoform X1 [Rattus norvegicus]
GI:61556820 RefSeq XP_006254246.1 323 PREDICTED: aldo-keto reductase family 1 member C21 isoform X1 [Rattus norvegicus]
GI:61556820 SwissProt Q6AYQ2.1 318 RecName: Full=Aldo-keto reductase family 1 member C21; AltName: Full=17-alpha-hydroxysteroid dehydrogenase; Short=17-alpha-HSD; AltName: Full=3(or 17)-alpha-hydroxysteroid dehydrogenase; AltName: Full=3-alpha-hydroxysteroid dehydrogenase [Rattus norvegicus]