Gene/Proteome Database (LMPD)
LMPD ID
LMP013068
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 1, member C2
Gene Symbol
Synonyms
Akr1c21;
Alternate Names
aldo-keto reductase family 1 member C21; 17-alpha-HSD; 3-alpha-hydroxysteroid dehydrogenase; 17-alpha-hydroxysteroid dehydrogenase; aldo-keto reductase family 1, member C21; 3(or 17)-alpha-hydroxysteroid dehydrogenase;
Chromosome
17
Map Location
17q12.3
EC Number
1.1.1.-
Proteins
| aldo-keto reductase family 1 member C21 | |
|---|---|
| Refseq ID | NP_001013075 |
| Protein GI | 61556820 |
| UniProt ID | Q6AYQ2 |
| mRNA ID | NM_001013057 |
| Length | 318 |
| MNSKCHCVKLNDGHFIPVLGFGTAMPSELPKSKAKEVTKIAIDAGFHHFDSAFVYNTEDHVGEAIREKIANGTTRREDIFYTSKLWCTSLHPELVRSSLECSLKKLQLDYVDLYLIHFPMALKPGDENFPVDEHGKLLFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKYKPVCNQVECHLYLNQMKLLDFCKTNGIILVAYGVLGTQRYNGWVDQNSPVLLNEPVLSSMAKKYNQTPALIALRHQLQRGIVVLNTSLKEERIKENMKLSPEDMKVLDDLNRNLRYIAGGIFEGHPNFPFLDEY | |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member C2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0047023 | IEA:UniProtKB-EC | F | androsterone dehydrogenase activity |
| GO:0008202 | IEA:UniProtKB-KW | P | steroid metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953493 | Arachidonic acid metabolism |
| 5953720 | Bile acid and bile salt metabolism |
| 5953253 | Disease |
| 5953382 | Diseases associated with visual transduction |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5954392 | Retinoid metabolism and transport |
| 5953381 | Signal Transduction |
| 5953492 | Synthesis of Prostaglandins (PG) and Thromboxanes (TX) |
| 5953930 | Synthesis of bile acids and bile salts |
| 5953933 | Synthesis of bile acids and bile salts via 24-hydroxycholesterol |
| 5953929 | Synthesis of bile acids and bile salts via 27-hydroxycholesterol |
| 5953931 | Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol |
| 5953380 | Visual phototransduction |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member C2
Protein Entry
AK1CL_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Androsterone + NAD(P)(+) = 5-alpha-androstane- 3,17-dione + NAD(P)H. |
| Function | NADP-dependent 17-alpha-hydroxysteroid dehydrogenase that converts 5-alpha-androstane-3,17-dione into androsterone. Has lower 3-alpha-hydroxysteroid dehydrogenase activity. Has broad substrate specificity and acts on various 17-alpha- hydroxysteroids, 17-ketosteroids, 3-alpha hydroxysteroids and 3- ketosteroids. Reduction of keto groups is strictly stereoselective. Reduction of 17-ketosteroids yields only 17- alpha-hydroxysteroids. Likewise, reduction of 3-ketosteroids yields only 3-alpha-hydroxysteroids (By similarity) |
| Similarity | Belongs to the aldo/keto reductase family |
| Subcellular Location | Cytoplasm . |
| Subunit | Monomer |
Identical and Related Proteins
Unique RefSeq proteins for LMP013068 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 61556820 | RefSeq | NP_001013075 | 318 | aldo-keto reductase family 1 member C21 |
Identical Sequences to LMP013068 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61556820 | GenBank | AAH78957.1 | 318 | Aldo-keto reductase family 1, member C21 [Rattus norvegicus] |
| GI:61556820 | SwissProt | Q6AYQ2.1 | 318 | RecName: Full=Aldo-keto reductase family 1 member C21; AltName: Full=17-alpha-hydroxysteroid dehydrogenase; Short=17-alpha-HSD; AltName: Full=3(or 17)-alpha-hydroxysteroid dehydrogenase; AltName: Full=3-alpha-hydroxysteroid dehydrogenase [Rattus norvegicus] |
Related Sequences to LMP013068 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61556820 | GenBank | AAH78957.1 | 318 | Aldo-keto reductase family 1, member C21 [Rattus norvegicus] |
| GI:61556820 | RefSeq | XP_006254245.1 | 323 | PREDICTED: aldo-keto reductase family 1 member C21 isoform X1 [Rattus norvegicus] |
| GI:61556820 | RefSeq | XP_006254246.1 | 323 | PREDICTED: aldo-keto reductase family 1 member C21 isoform X1 [Rattus norvegicus] |
| GI:61556820 | SwissProt | Q6AYQ2.1 | 318 | RecName: Full=Aldo-keto reductase family 1 member C21; AltName: Full=17-alpha-hydroxysteroid dehydrogenase; Short=17-alpha-HSD; AltName: Full=3(or 17)-alpha-hydroxysteroid dehydrogenase; AltName: Full=3-alpha-hydroxysteroid dehydrogenase [Rattus norvegicus] |