Gene/Proteome Database (LMPD)

LMPD ID
LMP013078
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
solute carrier family 27 (fatty acid transporter), member 6
Gene Symbol
Alternate Names
long-chain fatty acid transport protein 6;
Chromosome
18
Map Location
18q12.1

Proteins

long-chain fatty acid transport protein 6
Refseq ID NP_001099615
Protein GI 157817642
UniProt ID D4A2B8
mRNA ID NM_001106145
Length 619
MLLSWLTGFGAGLLSLHFVQKLLFPYFWDDLWFLLKLVRYGIQMEIYKLRGELVTVLDKFLSHARRQPKKAFIIYEGDVYTYEDVDKRSNRVAHALLNHSDLKRGDVVALLMSNEPDFVHVWFGLAKLGCVVAFLNSNLRFESLLHCIRTSEPKAMVVGEDLLGSLEEILPSLPKHIRVWGMKDSVPEGIVSLKEKLSLASDEPVPPSHHVTSSLKSTCLYIFTSGTTGLPKAAVISQFQVLKGSFGLWAFGCTADDIVYITLPLYHSSGALLGIGGCVELGATCVLKKKFSASQFWNDCRKYNVTVFQYIGELCRYLCKQPQREGEKDHRVRLAVGNGMSSDVWRQFLDRFGNIKMCEFYGATEGNICFMNHTGKIGSVGRVNFFYNLLFSFELIKYDFQKDEPLRNEQGWCYCVRKGEPGLLVSRVNKKNPFFGYTGSYKQTKSKLLFDVFKKGDVYFNTGDLMFQDHENFLYFWDRIGDTFRWKGENVATTEVANVLGRLDFIQEANVYGVPVPGYEGKAGMTSIILKPNKSLDLEKMYDQVVTSLPAYACPRFLRIQDKMETTGTFKLKKLQLVEEGFNPLKIADPLYFMDNLKKSYVPLTQEIYNQVMLEELKL

Gene Information

Entrez Gene ID
Gene Name
solute carrier family 27 (fatty acid transporter), member 6
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031957 IEA:Ensembl F very long-chain fatty acid-CoA ligase activity

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5953264 SLC-mediated transmembrane transport
5953265 Transmembrane transport of small molecules
5954357 Transport of fatty acids
5953520 Transport of vitamins, nucleosides, and related molecules

Domain Information

InterPro Annotations

Accession Description
IPR025110 AMP-binding enzyme C-terminal domain
IPR020845 AMP-binding, conserved site
IPR000873 AMP-dependent synthetase/ligase

UniProt Annotations

Entry Information

Gene Name
solute carrier family 27 (fatty acid transporter), member 6
Protein Entry
D4A2B8_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013078 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157817642 RefSeq NP_001099615 619 long-chain fatty acid transport protein 6

Identical Sequences to LMP013078 proteins

Reference Database Accession Length Protein Name
GI:157817642 GenBank EDM14523.1 619 solute carrier family 27 (fatty acid transporter), member 6 (predicted) [Rattus norvegicus]

Related Sequences to LMP013078 proteins

Reference Database Accession Length Protein Name
GI:157817642 GenBank AAI15436.1 619 Solute carrier family 27 (fatty acid transporter), member 6 [Mus musculus]
GI:157817642 GenBank EDM14523.1 619 solute carrier family 27 (fatty acid transporter), member 6 (predicted) [Rattus norvegicus]
GI:157817642 RefSeq NP_001074541.1 619 long-chain fatty acid transport protein 6 [Mus musculus]
GI:157817642 RefSeq XP_005069147.1 619 PREDICTED: long-chain fatty acid transport protein 6 [Mesocricetus auratus]