Gene/Proteome Database (LMPD)
Proteins
| long-chain fatty acid transport protein 6 | |
|---|---|
| Refseq ID | NP_001099615 |
| Protein GI | 157817642 |
| UniProt ID | D4A2B8 |
| mRNA ID | NM_001106145 |
| Length | 619 |
| MLLSWLTGFGAGLLSLHFVQKLLFPYFWDDLWFLLKLVRYGIQMEIYKLRGELVTVLDKFLSHARRQPKKAFIIYEGDVYTYEDVDKRSNRVAHALLNHSDLKRGDVVALLMSNEPDFVHVWFGLAKLGCVVAFLNSNLRFESLLHCIRTSEPKAMVVGEDLLGSLEEILPSLPKHIRVWGMKDSVPEGIVSLKEKLSLASDEPVPPSHHVTSSLKSTCLYIFTSGTTGLPKAAVISQFQVLKGSFGLWAFGCTADDIVYITLPLYHSSGALLGIGGCVELGATCVLKKKFSASQFWNDCRKYNVTVFQYIGELCRYLCKQPQREGEKDHRVRLAVGNGMSSDVWRQFLDRFGNIKMCEFYGATEGNICFMNHTGKIGSVGRVNFFYNLLFSFELIKYDFQKDEPLRNEQGWCYCVRKGEPGLLVSRVNKKNPFFGYTGSYKQTKSKLLFDVFKKGDVYFNTGDLMFQDHENFLYFWDRIGDTFRWKGENVATTEVANVLGRLDFIQEANVYGVPVPGYEGKAGMTSIILKPNKSLDLEKMYDQVVTSLPAYACPRFLRIQDKMETTGTFKLKKLQLVEEGFNPLKIADPLYFMDNLKKSYVPLTQEIYNQVMLEELKL | |
Gene Information
Entrez Gene ID
Gene Name
solute carrier family 27 (fatty acid transporter), member 6
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031957 | IEA:Ensembl | F | very long-chain fatty acid-CoA ligase activity |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
solute carrier family 27 (fatty acid transporter), member 6
Protein Entry
D4A2B8_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013078 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157817642 | RefSeq | NP_001099615 | 619 | long-chain fatty acid transport protein 6 |
Identical Sequences to LMP013078 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157817642 | GenBank | EDM14523.1 | 619 | solute carrier family 27 (fatty acid transporter), member 6 (predicted) [Rattus norvegicus] |
Related Sequences to LMP013078 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157817642 | GenBank | AAI15436.1 | 619 | Solute carrier family 27 (fatty acid transporter), member 6 [Mus musculus] |
| GI:157817642 | GenBank | EDM14523.1 | 619 | solute carrier family 27 (fatty acid transporter), member 6 (predicted) [Rattus norvegicus] |
| GI:157817642 | RefSeq | NP_001074541.1 | 619 | long-chain fatty acid transport protein 6 [Mus musculus] |
| GI:157817642 | RefSeq | XP_005069147.1 | 619 | PREDICTED: long-chain fatty acid transport protein 6 [Mesocricetus auratus] |