Gene/Proteome Database (LMPD)
Proteins
| stAR-related lipid transfer protein 4 | |
|---|---|
| Refseq ID | NP_001099629 |
| Protein GI | 157822051 |
| UniProt ID | D3Z9I9 |
| mRNA ID | NM_001106159 |
| Length | 224 |
| MADPGSGWSQSSRKLKMEGLSDVASISTKLQNTLIQYHSIEEDQWRVAKKVKDVTVWRKPSEEFNGYLYKAQGVMDDVVNNVIDHIRPGPWRLDWDRLMTSLDILEHFEENCCVMRYTTAGQLLNIISPREFVDFSYTVGYEEGLLSCGVSVEWSETRPEFVRGYNHPCGWFCVPLKDSPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLANFYSDLRKALRKA | |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 4
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:InterPro | F | lipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 4
Protein Entry
D3Z9I9_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013079 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157822051 | RefSeq | NP_001099629 | 224 | stAR-related lipid transfer protein 4 |
Identical Sequences to LMP013079 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822051 | GenBank | EDL76199.1 | 224 | StAR-related lipid transfer (START) domain containing 4 (predicted) [Rattus norvegicus] |
Related Sequences to LMP013079 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822051 | GenBank | AAL87127.1 | 224 | StAR-related lipid transfer protein 4 [Mus musculus] |
| GI:157822051 | GenBank | EDL76199.1 | 224 | StAR-related lipid transfer (START) domain containing 4 (predicted) [Rattus norvegicus] |
| GI:157822051 | PDB | 1JSS | 224 | Chain A, Crystal Structure Of The Mus Musculus Cholesterol-Regulated Start Protein 4 (Stard4). |
| GI:157822051 | RefSeq | NP_598535.1 | 224 | stAR-related lipid transfer protein 4 [Mus musculus] |