Gene/Proteome Database (LMPD)
LMPD ID
LMP013084
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
progesterone receptor membrane component 1
Gene Symbol
Synonyms
MPR; 25Dx; VEMA; 25-Dx;
Alternate Names
membrane-associated progesterone receptor component 1; acidic 25 kDa protein; ventral midline antigen; membrane-bound progesterone receptor;
Chromosome
X
Map Location
Xq12
Summary
may be involved in regulation of axon guidance in the central nervous system [RGD, Feb 2006]
Orthologs
Proteins
| membrane-associated progesterone receptor component 1 | |
|---|---|
| Refseq ID | NP_068534 |
| Protein GI | 11120720 |
| UniProt ID | P70580 |
| mRNA ID | NM_021766 |
| Length | 223 |
| MAAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKPRDFTPAELRRYDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFSSPSSTITWGKLLEGAEEPIVYSDDEEQKMRLLGRVTEAVSGAYLFLYFAKSFVTFQSVFTTW | |
Gene Information
Entrez Gene ID
Gene Name
progesterone receptor membrane component 1
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005730 | IEA:Ensembl | C | nucleolus |
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005496 | IEA:UniProtKB-KW | F | steroid binding |
| GO:0007411 | IEP:RGD | P | axon guidance |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001199 | Cytochrome b5-like heme/steroid binding domain |
UniProt Annotations
Entry Information
Gene Name
progesterone receptor membrane component 1
Protein Entry
PGRC1_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Domain | The cytochrome b5 heme-binding domain lacks the conserved iron-binding His residues at positions 107 and 131 |
| Function | Receptor for progesterone (By similarity). May be implicated in 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) immunotoxicity |
| Induction | By dioxin. |
| Similarity | Belongs to the cytochrome b5 family. MAPR subfamily |
| Similarity | Contains 1 cytochrome b5 heme-binding domain |
| Subcellular Location | Microsome membrane ; Single- pass membrane protein . Endoplasmic reticulum membrane ; Single-pass membrane protein . |
| Tissue Specificity | Expressed at high levels in lung, liver, kidney and brain, low in testis and spleen. Not expressed in heart and skeletal muscle. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013084 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 11120720 | RefSeq | NP_068534 | 223 | membrane-associated progesterone receptor component 1 |
Identical Sequences to LMP013084 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:11120720 | GenBank | AAB07125.1 | 223 | 25-Dx [Rattus norvegicus] |
| GI:11120720 | GenBank | ABW60945.1 | 223 | Sequence 22 from patent US 7279284 |
| GI:11120720 | GenBank | AFL62088.1 | 223 | Sequence 3 from patent US 8187821 |
Related Sequences to LMP013084 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:11120720 | EMBL | CAA06732.1 | 195 | putative progesterone binding protein [Rattus norvegicus] |
| GI:11120720 | GenBank | AAB07125.1 | 223 | 25-Dx [Rattus norvegicus] |
| GI:11120720 | GenBank | ABW60945.1 | 223 | Sequence 22 from patent US 7279284 |
| GI:11120720 | GenBank | AFL62088.1 | 223 | Sequence 3 from patent US 8187821 |