Gene/Proteome Database (LMPD)

LMPD ID
LMP013084
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
progesterone receptor membrane component 1
Gene Symbol
Synonyms
MPR; 25Dx; VEMA; 25-Dx;
Alternate Names
membrane-associated progesterone receptor component 1; acidic 25 kDa protein; ventral midline antigen; membrane-bound progesterone receptor;
Chromosome
X
Map Location
Xq12
Summary
may be involved in regulation of axon guidance in the central nervous system [RGD, Feb 2006]
Orthologs

Proteins

membrane-associated progesterone receptor component 1
Refseq ID NP_068534
Protein GI 11120720
UniProt ID P70580
mRNA ID NM_021766
Length 223
MAAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKPRDFTPAELRRYDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFSSPSSTITWGKLLEGAEEPIVYSDDEEQKMRLLGRVTEAVSGAYLFLYFAKSFVTFQSVFTTW

Gene Information

Entrez Gene ID
Gene Name
progesterone receptor membrane component 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005730 IEA:Ensembl C nucleolus
GO:0020037 IEA:InterPro F heme binding
GO:0005496 IEA:UniProtKB-KW F steroid binding
GO:0007411 IEP:RGD P axon guidance

Domain Information

InterPro Annotations

Accession Description
IPR001199 Cytochrome b5-like heme/steroid binding domain

UniProt Annotations

Entry Information

Gene Name
progesterone receptor membrane component 1
Protein Entry
PGRC1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Domain The cytochrome b5 heme-binding domain lacks the conserved iron-binding His residues at positions 107 and 131
Function Receptor for progesterone (By similarity). May be implicated in 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) immunotoxicity
Induction By dioxin.
Similarity Belongs to the cytochrome b5 family. MAPR subfamily
Similarity Contains 1 cytochrome b5 heme-binding domain
Subcellular Location Microsome membrane ; Single- pass membrane protein . Endoplasmic reticulum membrane ; Single-pass membrane protein .
Tissue Specificity Expressed at high levels in lung, liver, kidney and brain, low in testis and spleen. Not expressed in heart and skeletal muscle.

Identical and Related Proteins

Unique RefSeq proteins for LMP013084 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
11120720 RefSeq NP_068534 223 membrane-associated progesterone receptor component 1

Identical Sequences to LMP013084 proteins

Reference Database Accession Length Protein Name
GI:11120720 GenBank AAB07125.1 223 25-Dx [Rattus norvegicus]
GI:11120720 GenBank ABW60945.1 223 Sequence 22 from patent US 7279284
GI:11120720 GenBank AFL62088.1 223 Sequence 3 from patent US 8187821

Related Sequences to LMP013084 proteins

Reference Database Accession Length Protein Name
GI:11120720 EMBL CAA06732.1 195 putative progesterone binding protein [Rattus norvegicus]
GI:11120720 GenBank AAB07125.1 223 25-Dx [Rattus norvegicus]
GI:11120720 GenBank ABW60945.1 223 Sequence 22 from patent US 7279284
GI:11120720 GenBank AFL62088.1 223 Sequence 3 from patent US 8187821