Gene/Proteome Database (LMPD)
Proteins
| PCTP-like protein | |
|---|---|
| Refseq ID | NP_001013087 |
| Protein GI | 61556854 |
| UniProt ID | Q5BJN1 |
| mRNA ID | NM_001013069 |
| Length | 290 |
| MEKPAASTEPQGPRPALGRESVQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVTESREERAGGAGEGSDDDTSLT | |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 10
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IEA:Ensembl | C | cytosol |
| GO:0046581 | IEA:Ensembl | C | intercellular canaliculus |
| GO:0016020 | IEA:Ensembl | C | membrane |
| GO:0005902 | IEA:Ensembl | C | microvillus |
| GO:0008289 | IEA:InterPro | F | lipid binding |
| GO:0032782 | IEA:Ensembl | P | bile acid secretion |
| GO:0035360 | IEA:Ensembl | P | positive regulation of peroxisome proliferator activated receptor signaling pathway |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 10
Protein Entry
Q5BJN1_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013098 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 61556854 | RefSeq | NP_001013087 | 290 | PCTP-like protein |
Identical Sequences to LMP013098 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61556854 | GenBank | EDM18289.1 | 290 | START domain containing 10, isoform CRA_b [Rattus norvegicus] |
| GI:61556854 | GenBank | EDM18291.1 | 290 | START domain containing 10, isoform CRA_b [Rattus norvegicus] |
| GI:61556854 | GenBank | EDM18292.1 | 290 | START domain containing 10, isoform CRA_b [Rattus norvegicus] |
| GI:61556854 | RefSeq | XP_006229913.1 | 290 | PREDICTED: PCTP-like protein isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013098 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61556854 | GenBank | AAH91411.1 | 290 | StAR-related lipid transfer (START) domain containing 10 [Rattus norvegicus] |
| GI:61556854 | GenBank | EDM18289.1 | 290 | START domain containing 10, isoform CRA_b [Rattus norvegicus] |
| GI:61556854 | GenBank | EDM18291.1 | 290 | START domain containing 10, isoform CRA_b [Rattus norvegicus] |
| GI:61556854 | GenBank | EDM18292.1 | 290 | START domain containing 10, isoform CRA_b [Rattus norvegicus] |