Gene/Proteome Database (LMPD)

LMPD ID
LMP013098
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
StAR-related lipid transfer (START) domain containing 10
Gene Symbol
Alternate Names
PCTP-like protein; START domain containing 10;
Chromosome
1
Map Location
1q32

Proteins

PCTP-like protein
Refseq ID NP_001013087
Protein GI 61556854
UniProt ID Q5BJN1
mRNA ID NM_001013069
Length 290
MEKPAASTEPQGPRPALGRESVQVPDDQDFRSFRSECEAEVGWNLTYSKAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVTESREERAGGAGEGSDDDTSLT

Gene Information

Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 10
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0046581 IEA:Ensembl C intercellular canaliculus
GO:0016020 IEA:Ensembl C membrane
GO:0005902 IEA:Ensembl C microvillus
GO:0008289 IEA:InterPro F lipid binding
GO:0032782 IEA:Ensembl P bile acid secretion
GO:0035360 IEA:Ensembl P positive regulation of peroxisome proliferator activated receptor signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom

UniProt Annotations

Entry Information

Gene Name
StAR-related lipid transfer (START) domain containing 10
Protein Entry
Q5BJN1_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013098 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
61556854 RefSeq NP_001013087 290 PCTP-like protein

Identical Sequences to LMP013098 proteins

Reference Database Accession Length Protein Name
GI:61556854 GenBank EDM18289.1 290 START domain containing 10, isoform CRA_b [Rattus norvegicus]
GI:61556854 GenBank EDM18291.1 290 START domain containing 10, isoform CRA_b [Rattus norvegicus]
GI:61556854 GenBank EDM18292.1 290 START domain containing 10, isoform CRA_b [Rattus norvegicus]
GI:61556854 RefSeq XP_006229913.1 290 PREDICTED: PCTP-like protein isoform X1 [Rattus norvegicus]

Related Sequences to LMP013098 proteins

Reference Database Accession Length Protein Name
GI:61556854 GenBank AAH91411.1 290 StAR-related lipid transfer (START) domain containing 10 [Rattus norvegicus]
GI:61556854 GenBank EDM18289.1 290 START domain containing 10, isoform CRA_b [Rattus norvegicus]
GI:61556854 GenBank EDM18291.1 290 START domain containing 10, isoform CRA_b [Rattus norvegicus]
GI:61556854 GenBank EDM18292.1 290 START domain containing 10, isoform CRA_b [Rattus norvegicus]