Gene/Proteome Database (LMPD)
Proteins
| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma | |
|---|---|
| Refseq ID | NP_001099848 |
| Protein GI | 157822443 |
| UniProt ID | G3V648 |
| mRNA ID | NM_001106378 |
| Length | 376 |
| MGLLAYLKTQFVVHLLIGFVFVVSGLIINFTQLCTLALWPISKNLYRRINCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVNHFGKEHVVVILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVIEGLRRLANYPEYMWFLLYCEGTRFTETKHRVSMEVAASKGLPPLKYHLLPRTKGFTTAVQCLRGTVAAIYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFPLEDIPADETGAAQWLHKLYQEKDALQEMYKQSGVFPGEQIKPARRPWTLLNFLCWATFLLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYGNQELKKKE | |
Gene Information
Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 3
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0016746 | IEA:UniProtKB-KW | F | transferase activity, transferring acyl groups |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00561 | Glycerolipid metabolism |
| rno00561 | Glycerolipid metabolism |
| ko00564 | Glycerophospholipid metabolism |
| rno00564 | Glycerophospholipid metabolism |
| rno01100 | Metabolic pathways |
| M00089 | Triacylglycerol biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 3
Protein Entry
G3V648_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013119 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157822443 | RefSeq | NP_001099848 | 376 | 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma |
Identical Sequences to LMP013119 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822443 | GenBank | EDL97051.1 | 376 | 1-acylglycerol-3-phosphate O-acyltransferase 3 (predicted), isoform CRA_b [Rattus norvegicus] |
| GI:157822443 | GenBank | EDL97052.1 | 376 | 1-acylglycerol-3-phosphate O-acyltransferase 3 (predicted), isoform CRA_b [Rattus norvegicus] |
| GI:157822443 | RefSeq | XP_006256305.1 | 376 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma isoform X1 [Rattus norvegicus] |
| GI:157822443 | RefSeq | XP_006256306.1 | 376 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013119 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822443 | GenBank | EDL97048.1 | 376 | 1-acylglycerol-3-phosphate O-acyltransferase 3 (predicted), isoform CRA_b [Rattus norvegicus] |
| GI:157822443 | GenBank | EDL97049.1 | 376 | 1-acylglycerol-3-phosphate O-acyltransferase 3 (predicted), isoform CRA_b [Rattus norvegicus] |
| GI:157822443 | RefSeq | XP_006256305.1 | 376 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma isoform X1 [Rattus norvegicus] |
| GI:157822443 | RefSeq | XP_006256306.1 | 376 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma isoform X1 [Rattus norvegicus] |