Gene/Proteome Database (LMPD)
LMPD ID
LMP013127
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
ALG5, dolichyl-phosphate beta-glucosyltransferase
Gene Symbol
Alternate Names
dolichyl-phosphate beta-glucosyltransferase; asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog; asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase); asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphate beta-glucosyltransferase);
Chromosome
2
Map Location
2q26
Proteins
| dolichyl-phosphate beta-glucosyltransferase | |
|---|---|
| Refseq ID | NP_001020578 |
| Protein GI | 70794776 |
| UniProt ID | Q4QQS6 |
| mRNA ID | NM_001025407 |
| Length | 324 |
| MASLLLQLVGLGVALAAAALILVSIVAFITATKMPPCHRHEEEKFFLNARGQKEALPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALNYLEKRQKHDRTFTYEVIVVDDGSEDQTSKVALKYCQKYGSDKVRVITLVQNRGKGGAVRMGVFSSRGEKILMADADGATKFPDVEKLEKGLSDLQPWPEQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLLTREAAARTFSSLHIERWAFDVELLYIAQFLQIPIAEVAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKVS | |
Gene Information
Entrez Gene ID
Gene Name
ALG5, dolichyl-phosphate beta-glucosyltransferase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:Ensembl | C | membrane |
| GO:0016757 | IEA:UniProtKB-KW | F | transferase activity, transferring glycosyl groups |
| GO:0007368 | IEA:Ensembl | P | determination of left/right symmetry |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| rno01100 | Metabolic pathways |
| ko00510 | N-Glycan biosynthesis |
| rno00510 | N-Glycan biosynthesis |
| M00055 | N-glycan precursor biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953739 | Asparagine N-linked glycosylation |
| 5953738 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
| 5953345 | Metabolism of proteins |
| 5953728 | Post-translational protein modification |
| 5954306 | Synthesis of dolichyl-phosphate-glucose |
| 5953737 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ALG5, dolichyl-phosphate beta-glucosyltransferase
Protein Entry
Q4QQS6_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013127 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 70794776 | RefSeq | NP_001020578 | 324 | dolichyl-phosphate beta-glucosyltransferase |
Identical Sequences to LMP013127 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:70794776 | GenBank | AAH98039.1 | 324 | Asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) [Rattus norvegicus] |
| GI:70794776 | GenBank | EDM14914.1 | 324 | asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase), isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP013127 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:70794776 | GenBank | AAH27160.1 | 324 | Asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase) [Mus musculus] |
| GI:70794776 | GenBank | AAH98039.1 | 324 | Asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) [Rattus norvegicus] |
| GI:70794776 | GenBank | EDM14914.1 | 324 | asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase), isoform CRA_a [Rattus norvegicus] |
| GI:70794776 | RefSeq | NP_079718.1 | 324 | dolichyl-phosphate beta-glucosyltransferase [Mus musculus] |