Gene/Proteome Database (LMPD)
Proteins
GPI-anchor transamidase precursor | |
---|---|
Refseq ID | NP_001011953 |
Protein GI | 58865476 |
UniProt ID | Q5XIP2 |
mRNA ID | NM_001011953 |
Length | 395 |
MASPCFFTLPVAVLATLAFLSLGSSAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNARNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRVPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKKVLITDFFGSVRKVEITTETISLQWDSQVVDSSSAEDGMAEEPTEPLKFAEQLPVAQIIHQKPKLKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF | |
sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2615 peptide sequence: MASPCFFTLPVAVLATLAFLSLGSSA |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0042765 | ISS:UniProtKB | C | GPI-anchor transamidase complex |
GO:0003923 | ISS:UniProtKB | F | GPI-anchor transamidase activity |
GO:0004197 | IEA:InterPro | F | cysteine-type endopeptidase activity |
GO:0016255 | IEA:InterPro | P | attachment of GPI anchor to protein |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
rno00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
rno01100 | Metabolic pathways |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Protein Entry
Q5XIP2_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013131 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
58865476 | RefSeq | NP_001011953 | 395 | GPI-anchor transamidase precursor |
Identical Sequences to LMP013131 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58865476 | GenBank | AAH83636.1 | 395 | Phosphatidylinositol glycan, class K [Rattus norvegicus] |
GI:58865476 | GenBank | EDL82509.1 | 395 | rCG29025, isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP013131 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58865476 | DBBJ | BAC37051.1 | 395 | unnamed protein product [Mus musculus] |
GI:58865476 | GenBank | AAH83636.1 | 395 | Phosphatidylinositol glycan, class K [Rattus norvegicus] |
GI:58865476 | GenBank | EDL82509.1 | 395 | rCG29025, isoform CRA_a [Rattus norvegicus] |
GI:58865476 | SwissProt | Q9CXY9.2 | 395 | RecName: Full=GPI-anchor transamidase; Short=GPI transamidase; AltName: Full=Phosphatidylinositol-glycan biosynthesis class K protein; Short=PIG-K; Flags: Precursor [Mus musculus] |