Gene/Proteome Database (LMPD)

LMPD ID
LMP013131
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Gene Symbol
Alternate Names
GPI-anchor transamidase; phosphatidylinositol glycan, class K;
Chromosome
2
Map Location
2q45

Proteins

GPI-anchor transamidase precursor
Refseq ID NP_001011953
Protein GI 58865476
UniProt ID Q5XIP2
mRNA ID NM_001011953
Length 395
MASPCFFTLPVAVLATLAFLSLGSSAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNARNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRVPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKKVLITDFFGSVRKVEITTETISLQWDSQVVDSSSAEDGMAEEPTEPLKFAEQLPVAQIIHQKPKLKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF
sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2615 peptide sequence: MASPCFFTLPVAVLATLAFLSLGSSA

Gene Information

Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042765 ISS:UniProtKB C GPI-anchor transamidase complex
GO:0003923 ISS:UniProtKB F GPI-anchor transamidase activity
GO:0004197 IEA:InterPro F cysteine-type endopeptidase activity
GO:0016255 IEA:InterPro P attachment of GPI anchor to protein

KEGG Pathway Links

KEGG Pathway ID Description
ko00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
rno00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5953740 Attachment of GPI anchor to uPAR
5953345 Metabolism of proteins
5953735 Post-translational modification: synthesis of GPI-anchored proteins
5953728 Post-translational protein modification

Domain Information

InterPro Annotations

Accession Description
IPR028361 GPI-anchor transamidase
IPR001096 Peptidase C13, legumain

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Protein Entry
Q5XIP2_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013131 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58865476 RefSeq NP_001011953 395 GPI-anchor transamidase precursor

Identical Sequences to LMP013131 proteins

Reference Database Accession Length Protein Name
GI:58865476 GenBank AAH83636.1 395 Phosphatidylinositol glycan, class K [Rattus norvegicus]
GI:58865476 GenBank EDL82509.1 395 rCG29025, isoform CRA_a [Rattus norvegicus]

Related Sequences to LMP013131 proteins

Reference Database Accession Length Protein Name
GI:58865476 DBBJ BAC37051.1 395 unnamed protein product [Mus musculus]
GI:58865476 GenBank AAH83636.1 395 Phosphatidylinositol glycan, class K [Rattus norvegicus]
GI:58865476 GenBank EDL82509.1 395 rCG29025, isoform CRA_a [Rattus norvegicus]
GI:58865476 SwissProt Q9CXY9.2 395 RecName: Full=GPI-anchor transamidase; Short=GPI transamidase; AltName: Full=Phosphatidylinositol-glycan biosynthesis class K protein; Short=PIG-K; Flags: Precursor [Mus musculus]