Gene/Proteome Database (LMPD)

LMPD ID
LMP013149
Gene ID
297073
Species
Rattus norvegicus (Rat)
Gene Name
retinoic acid receptor responder (tazarotene induced) 2
Gene Symbol
Rarres2
Alternate Names
retinoic acid receptor responder protein 2; chemerin;
Chromosome
4
Map Location
4q24

Proteins

retinoic acid receptor responder protein 2 precursor
Refseq ID NP_001013445
Protein GI 61740621
UniProt ID Q5BK77
mRNA ID NM_001013427
Length 163
MKCLLISLALWLGTADIHGTELELSETQRRGLQVALEEFHRHPPVQWAFQEIGVDSADDLFFSAGTFVRLEFKLQQTSCLKKDWKKPECTIKPNGRKRKCLACIKLDPKGKVLGRMVHCPILKQGPQQEPQESQCSKIAQAGEDSRIYFFPGQFAFSRALQSK
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2056 peptide sequence: MKCLLISLALWLGTADIHG

Gene Information

Entrez Gene ID
297073
Gene Name
retinoic acid receptor responder (tazarotene induced) 2
Gene Symbol
Rarres2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031012 IEA:Ensembl C extracellular matrix
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0050873 IEA:Ensembl P brown fat cell differentiation
GO:0048566 IEA:Ensembl P embryonic digestive tract development
GO:0006954 IEA:InterPro P inflammatory response
GO:0001701 IEA:Ensembl P in utero embryonic development
GO:0045600 IEA:Ensembl P positive regulation of fat cell differentiation
GO:2001275 IEA:Ensembl P positive regulation of glucose import in response to insulin stimulus
GO:0010759 IEA:Ensembl P positive regulation of macrophage chemotaxis
GO:0001934 IEA:Ensembl P positive regulation of protein phosphorylation
GO:0050994 IEA:Ensembl P regulation of lipid catabolic process
GO:0001523 IEA:Ensembl P retinoid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR029562 Retinoic acid receptor responder protein 2

UniProt Annotations

Entry Information

Gene Name
retinoic acid receptor responder (tazarotene induced) 2
Protein Entry
Q5BK77_RAT
UniProt ID
Q5BK77
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013149 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
61740621 RefSeq NP_001013445 163 retinoic acid receptor responder protein 2 precursor

Identical Sequences to LMP013149 proteins

Reference Database Accession Length Protein Name
GI:61740621 GenBank AAH91177.1 163 Retinoic acid receptor responder (tazarotene induced) 2 [Rattus norvegicus]
GI:61740621 GenBank EDL88257.1 163 retinoic acid receptor responder (tazarotene induced) 2, isoform CRA_a [Rattus norvegicus]
GI:61740621 GenBank EDL88258.1 163 retinoic acid receptor responder (tazarotene induced) 2, isoform CRA_a [Rattus norvegicus]
GI:61740621 RefSeq XP_006236477.1 163 PREDICTED: retinoic acid receptor responder protein 2 isoform X1 [Rattus norvegicus]

Related Sequences to LMP013149 proteins

Reference Database Accession Length Protein Name
GI:61740621 GenBank AAH91177.1 163 Retinoic acid receptor responder (tazarotene induced) 2 [Rattus norvegicus]
GI:61740621 GenBank EDL88257.1 163 retinoic acid receptor responder (tazarotene induced) 2, isoform CRA_a [Rattus norvegicus]
GI:61740621 GenBank EDL88258.1 163 retinoic acid receptor responder (tazarotene induced) 2, isoform CRA_a [Rattus norvegicus]
GI:61740621 RefSeq XP_006236477.1 163 PREDICTED: retinoic acid receptor responder protein 2 isoform X1 [Rattus norvegicus]