Gene/Proteome Database (LMPD)

LMPD ID
LMP013176
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
retinol dehydrogenase 16 (all-trans)
Gene Symbol
Synonyms
Rdh2; RoDHII;
Alternate Names
retinol dehydrogenase 2; RODH II; 29 kDa protein; retinol dehydrogenase type 2; retinol dehydrogenase type II (RODH II);
Chromosome
7
Map Location
7q22
EC Number
1.1.1.105
Summary
a short-chain dehydrogenase/reductase that catalyzes the conversion of retinol to retinal, the first step in retinoic acid synthesis [RGD, Feb 2006]
Orthologs

Proteins

retinol dehydrogenase 2 precursor
Refseq ID NP_954678
Protein GI 40363270
UniProt ID P50170
mRNA ID NM_199208
Length 317
MWLYLLALVGLWNLLRLFRERKVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEQLRSKTSDRLETVILDVTKTESIVAATQWVKERVGNTGLWGLVNNAGISGHLGPNEWMNKQNIASVLDVNLLGMIEVTLSTVPLVRKARGRVVNVASIAGRLSFCGGGYCISKYGVEAFSDSLRRELSYFGVKVAIVEPGFFRTDVTNGVTLSSNFQMLWDQTSSEVREVYGENYLASYLKMLNGLDQRCNKDLSLVTDCMEHALTSCHPRTRYSAGWDAKFFYLPMSYLPTFLVDALFYWTSPKPEKAL
sig_peptide: 1..17 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2088 peptide sequence: MWLYLLALVGLWNLLRL

Gene Information

Entrez Gene ID
Gene Name
retinol dehydrogenase 16 (all-trans)
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0004745 IDA:RGD F retinol dehydrogenase activity
GO:0042573 IDA:RGD P retinoic acid metabolic process
GO:0042572 IDA:RGD P retinol metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
retinol dehydrogenase 16 (all-trans)
Protein Entry
RDH2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity All-trans-retinol-[cellular-retinol-binding- protein] + NAD(+) = all-trans-retinal-[cellular-retinol-binding- protein] + NADH.
Function Acts on retinol bound on cellular retinol-binding protein (CRBP). Has higher activity with NADP rather than NAD.
Pathway Cofactor metabolism; retinol metabolism.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family
Subcellular Location Microsome. Endoplasmic reticulum .
Tissue Specificity Liver > kidney > brain > lung > testis.

Identical and Related Proteins

Unique RefSeq proteins for LMP013176 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
40363270 RefSeq NP_954678 317 retinol dehydrogenase 2 precursor

Identical Sequences to LMP013176 proteins

Reference Database Accession Length Protein Name
GI:40363270 GenBank AAE26769.1 317 Sequence 3 from patent US 5952209
GI:40363270 GenBank AAE57308.1 317 Sequence 4 from patent US 6171837
GI:40363270 GenBank AAH79153.1 317 Retinol dehydrogenase 2 [Rattus norvegicus]
GI:40363270 GenBank ABP13397.1 317 Sequence 4 from patent US 7186534

Related Sequences to LMP013176 proteins

Reference Database Accession Length Protein Name
GI:40363270 GenBank AAC52316.1 317 retinol dehydrogenase type II [Rattus norvegicus]
GI:40363270 GenBank AAE01594.1 317 Sequence 3 from patent US 5858750
GI:40363270 GenBank AAE26769.1 317 Sequence 3 from patent US 5952209
GI:40363270 GenBank AAH79153.1 317 Retinol dehydrogenase 2 [Rattus norvegicus]