Gene/Proteome Database (LMPD)
Proteins
alkaline ceramidase 1 | |
---|---|
Refseq ID | NP_001100345 |
Protein GI | 157822473 |
UniProt ID | M0R603 |
mRNA ID | NM_001106875 |
Length | 273 |
MYAPSTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPYAQKRSWGIYGVSVLFMVIGLFSMYFHMTLSFVGQLLDEISILWLLASGYSVWLPRCYFPKFIKGSRFYFSCLVIMTTIISTFLTFVKPTVNAYALNSIAIHILYIVRKEYKKTSNRDLRHLIAVSVILWAAALTSWVSDRVLCSFWQRIQFFYLHSIWHVLISITFPYGIVTMALVDAKYEMPDKTLKVHYWPRDSWLIGLPYVEIQENDKNC |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016021 | IEA:InterPro | C | integral component of membrane |
GO:0071633 | IEA:Ensembl | F | dihydroceramidase activity |
GO:0071277 | IEA:Ensembl | P | cellular response to calcium ion |
GO:0046514 | IEA:Ensembl | P | ceramide catabolic process |
GO:0030216 | IEA:Ensembl | P | keratinocyte differentiation |
GO:0019216 | IEA:Ensembl | P | regulation of lipid metabolic process |
GO:0010446 | IEA:Ensembl | P | response to alkaline pH |
GO:0046512 | IEA:Ensembl | P | sphingosine biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
rno01100 | Metabolic pathways |
ko00600 | Sphingolipid metabolism |
rno00600 | Sphingolipid metabolism |
M00099 | Sphingosine biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR008901 | Ceramidase |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013201 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157822473 | RefSeq | NP_001100345 | 273 | alkaline ceramidase 1 |
Identical Sequences to LMP013201 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157822473 | GenBank | EDL83598.1 | 273 | similar to N-acylsphingosine amidohydrolase 3 [Rattus norvegicus] |
Related Sequences to LMP013201 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157822473 | GenBank | AAL83821.1 | 273 | alkaline ceramidase [Mus musculus] |
GI:157822473 | GenBank | AAI30255.1 | 273 | Alkaline ceramidase 1 [Mus musculus] |
GI:157822473 | GenBank | EDL83598.1 | 273 | similar to N-acylsphingosine amidohydrolase 3 [Rattus norvegicus] |
GI:157822473 | GenBank | AGF22455.1 | 273 | Sequence 15 from patent US 8372595 |