Gene/Proteome Database (LMPD)
Proteins
| fatty acid desaturase 6 | |
|---|---|
| Refseq ID | NP_001100534 |
| Protein GI | 157818323 |
| UniProt ID | D3ZEE9 |
| mRNA ID | NM_001107064 |
| Length | 342 |
| MEPTRSAPPGDGAAEALLKELERQVQDVVRASSWWERHGVDCAILALSLLALPAGFLCLRFHNVLAFATGITILGVCHYTLTVKGSHLATHSALTESKRWSKILMIFFVEVCTAFPAEFAKFNHVNMHHGYTNVLGLGDSSTWKMPLLNRYVYMLLGPLLVPLLTPLVALEHLRKEELKTALRALGFICLGLYSQYWLFMNVSGFKSPASALACMLLARSLLAHPYLHVNIFQHIGLPMFSPDKKPRRIHMMTLGVLNLPRQPVLDWAFGHSLISCHVEHHLFPWLSDHMCLKVKPVVSKFLHDKRLPYNEDSYLARFQLFLSRYEEFMVHVPPITELVGLQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005804 | Fatty acid desaturase, type 1 |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013230 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157818323 | RefSeq | NP_001100534 | 342 | fatty acid desaturase 6 |
Identical Sequences to LMP013230 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157818323 | GenBank | EDM06570.1 | 342 | fatty acid desaturase domain family, member 6 (predicted) [Rattus norvegicus] |
Related Sequences to LMP013230 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157818323 | GenBank | AAI32068.1 | 342 | Fatty acid desaturase domain family, member 6 [Mus musculus] |
| GI:157818323 | GenBank | EDM06570.1 | 342 | fatty acid desaturase domain family, member 6 (predicted) [Rattus norvegicus] |
| GI:157818323 | RefSeq | NP_828874.3 | 342 | fatty acid desaturase 6 [Mus musculus] |
| GI:157818323 | SwissProt | Q80UG1.1 | 342 | RecName: Full=Fatty acid desaturase 6 [Mus musculus] |