Gene/Proteome Database (LMPD)

LMPD ID
LMP013254
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Gene Symbol
Synonyms
Ugt2b34;
Alternate Names
UDP-glucuronosyltransferase 2B10; UDP glycosyltransferase 2 family, polypeptide B10; UDP glucuronosyltransferase 2 family, polypeptide B34;
Chromosome
14
Map Location
14p21

Proteins

UDP-glucuronosyltransferase 2B10 precursor
Refseq ID NP_001178605
Protein GI 300794198
UniProt ID D4A132
mRNA ID NM_001191676
Length 532
MSVKRTASLLLLLLQLSDFFGSGTGGKVLVWPMEFSHWLNLRVILDELLKKGHEVTVLRPSASLSYEVDNTSAIEFETYPTSYSLTEVDEFFWESLRKYIYELPKQSFWGYFLMFQELVWVDSDYFESLCKDVVFNKELMTKLQNSGFDVILADPFIPCGDLLAEILKIPLVYSLRFFPGSTYEKYSGGLPMPPSYVPIAMSELSDRMTFVERMKHMIYVLCFDFWFQAFNEKKWNELYTEVLGRPTTLSETMAKADIWLIRTYWDLEFPHPVLPNFDFVGGLHCRPAKPLPKEIEDFVQSSGEHGVVVFSLGSMVGNLTEERANVIAAGLAQIPQKVLWRFEGKKPETLGSNTRLYKWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQYDNIVHLKTKGAAVRLDFLTMSSTDLFTALKTITNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWVQYHSLDVIGFLLACVVTVMFILKKCCLFCCQKFTKAGRKKKRE
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2655 peptide sequence: MSVKRTASLLLLLLQLSDFFGSGTG

Gene Information

Entrez Gene ID
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016758 IEA:InterPro F transferase activity, transferring hexosyl groups

KEGG Pathway Links

KEGG Pathway ID Description
ko00053 Ascorbate and aldarate metabolism
rno00053 Ascorbate and aldarate metabolism
M00129 Ascorbate biosynthesis, animals, glucose-1P => ascorbate
ko05204 Chemical carcinogenesis
rno05204 Chemical carcinogenesis
ko00982 Drug metabolism - cytochrome P450
rno00982 Drug metabolism - cytochrome P450
ko00983 Drug metabolism - other enzymes
rno00983 Drug metabolism - other enzymes
M00014 Glucuronate pathway (uronate pathway)
rno01100 Metabolic pathways
ko00980 Metabolism of xenobiotics by cytochrome P450
rno00980 Metabolism of xenobiotics by cytochrome P450
ko00040 Pentose and glucuronate interconversions
rno00040 Pentose and glucuronate interconversions
ko00860 Porphyrin and chlorophyll metabolism
rno00860 Porphyrin and chlorophyll metabolism
ko00830 Retinol metabolism
rno00830 Retinol metabolism
ko00500 Starch and sucrose metabolism
rno00500 Starch and sucrose metabolism
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase

UniProt Annotations

Entry Information

Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Protein Entry
D4A132_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data
Similarity Belongs to the UDP-glycosyltransferase family

Identical and Related Proteins

Unique RefSeq proteins for LMP013254 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
300794198 RefSeq NP_001178605 532 UDP-glucuronosyltransferase 2B10 precursor

Identical Sequences to LMP013254 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP013254 proteins

Reference Database Accession Length Protein Name
GI:300794198 GenBank AAH28826.1 532 UDP glucuronosyltransferase 2 family, polypeptide B34 [Mus musculus]
GI:300794198 GenBank EDL37970.1 532 UDP glucuronosyltransferase 2 family, polypeptide B34 [Mus musculus]
GI:300794198 RefSeq NP_705826.1 532 UDP-glucuronosyltransferase 2B10 precursor [Mus musculus]
GI:300794198 RefSeq XP_006250871.1 530 PREDICTED: UDP-glucuronosyltransferase 2B31-like isoform X1 [Rattus norvegicus]