Gene/Proteome Database (LMPD)
LMPD ID
LMP013254
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Gene Symbol
Synonyms
Ugt2b34;
Alternate Names
UDP-glucuronosyltransferase 2B10; UDP glycosyltransferase 2 family, polypeptide B10; UDP glucuronosyltransferase 2 family, polypeptide B34;
Chromosome
14
Map Location
14p21
Proteins
| UDP-glucuronosyltransferase 2B10 precursor | |
|---|---|
| Refseq ID | NP_001178605 |
| Protein GI | 300794198 |
| UniProt ID | D4A132 |
| mRNA ID | NM_001191676 |
| Length | 532 |
| MSVKRTASLLLLLLQLSDFFGSGTGGKVLVWPMEFSHWLNLRVILDELLKKGHEVTVLRPSASLSYEVDNTSAIEFETYPTSYSLTEVDEFFWESLRKYIYELPKQSFWGYFLMFQELVWVDSDYFESLCKDVVFNKELMTKLQNSGFDVILADPFIPCGDLLAEILKIPLVYSLRFFPGSTYEKYSGGLPMPPSYVPIAMSELSDRMTFVERMKHMIYVLCFDFWFQAFNEKKWNELYTEVLGRPTTLSETMAKADIWLIRTYWDLEFPHPVLPNFDFVGGLHCRPAKPLPKEIEDFVQSSGEHGVVVFSLGSMVGNLTEERANVIAAGLAQIPQKVLWRFEGKKPETLGSNTRLYKWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQYDNIVHLKTKGAAVRLDFLTMSSTDLFTALKTITNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWVQYHSLDVIGFLLACVVTVMFILKKCCLFCCQKFTKAGRKKKRE | |
| sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2655 peptide sequence: MSVKRTASLLLLLLQLSDFFGSGTG | |
Gene Information
Entrez Gene ID
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016758 | IEA:InterPro | F | transferase activity, transferring hexosyl groups |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00053 | Ascorbate and aldarate metabolism |
| rno00053 | Ascorbate and aldarate metabolism |
| M00129 | Ascorbate biosynthesis, animals, glucose-1P => ascorbate |
| ko05204 | Chemical carcinogenesis |
| rno05204 | Chemical carcinogenesis |
| ko00982 | Drug metabolism - cytochrome P450 |
| rno00982 | Drug metabolism - cytochrome P450 |
| ko00983 | Drug metabolism - other enzymes |
| rno00983 | Drug metabolism - other enzymes |
| M00014 | Glucuronate pathway (uronate pathway) |
| rno01100 | Metabolic pathways |
| ko00980 | Metabolism of xenobiotics by cytochrome P450 |
| rno00980 | Metabolism of xenobiotics by cytochrome P450 |
| ko00040 | Pentose and glucuronate interconversions |
| rno00040 | Pentose and glucuronate interconversions |
| ko00860 | Porphyrin and chlorophyll metabolism |
| rno00860 | Porphyrin and chlorophyll metabolism |
| ko00830 | Retinol metabolism |
| rno00830 | Retinol metabolism |
| ko00500 | Starch and sucrose metabolism |
| rno00500 | Starch and sucrose metabolism |
| ko00140 | Steroid hormone biosynthesis |
| rno00140 | Steroid hormone biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002213 | UDP-glucuronosyl/UDP-glucosyltransferase |
UniProt Annotations
Entry Information
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Protein Entry
D4A132_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data |
| Similarity | Belongs to the UDP-glycosyltransferase family |
Identical and Related Proteins
Unique RefSeq proteins for LMP013254 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 300794198 | RefSeq | NP_001178605 | 532 | UDP-glucuronosyltransferase 2B10 precursor |
Identical Sequences to LMP013254 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP013254 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:300794198 | GenBank | AAH28826.1 | 532 | UDP glucuronosyltransferase 2 family, polypeptide B34 [Mus musculus] |
| GI:300794198 | GenBank | EDL37970.1 | 532 | UDP glucuronosyltransferase 2 family, polypeptide B34 [Mus musculus] |
| GI:300794198 | RefSeq | NP_705826.1 | 532 | UDP-glucuronosyltransferase 2B10 precursor [Mus musculus] |
| GI:300794198 | RefSeq | XP_006250871.1 | 530 | PREDICTED: UDP-glucuronosyltransferase 2B31-like isoform X1 [Rattus norvegicus] |