Gene/Proteome Database (LMPD)
LMPD ID
LMP013254
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Gene Symbol
Synonyms
Ugt2b34;
Alternate Names
UDP-glucuronosyltransferase 2B10; UDP glycosyltransferase 2 family, polypeptide B10; UDP glucuronosyltransferase 2 family, polypeptide B34;
Chromosome
14
Map Location
14p21
Proteins
UDP-glucuronosyltransferase 2B10 precursor | |
---|---|
Refseq ID | NP_001178605 |
Protein GI | 300794198 |
UniProt ID | D4A132 |
mRNA ID | NM_001191676 |
Length | 532 |
MSVKRTASLLLLLLQLSDFFGSGTGGKVLVWPMEFSHWLNLRVILDELLKKGHEVTVLRPSASLSYEVDNTSAIEFETYPTSYSLTEVDEFFWESLRKYIYELPKQSFWGYFLMFQELVWVDSDYFESLCKDVVFNKELMTKLQNSGFDVILADPFIPCGDLLAEILKIPLVYSLRFFPGSTYEKYSGGLPMPPSYVPIAMSELSDRMTFVERMKHMIYVLCFDFWFQAFNEKKWNELYTEVLGRPTTLSETMAKADIWLIRTYWDLEFPHPVLPNFDFVGGLHCRPAKPLPKEIEDFVQSSGEHGVVVFSLGSMVGNLTEERANVIAAGLAQIPQKVLWRFEGKKPETLGSNTRLYKWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQYDNIVHLKTKGAAVRLDFLTMSSTDLFTALKTITNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWVQYHSLDVIGFLLACVVTVMFILKKCCLFCCQKFTKAGRKKKRE | |
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2655 peptide sequence: MSVKRTASLLLLLLQLSDFFGSGTG |
Gene Information
Entrez Gene ID
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016758 | IEA:InterPro | F | transferase activity, transferring hexosyl groups |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00053 | Ascorbate and aldarate metabolism |
rno00053 | Ascorbate and aldarate metabolism |
M00129 | Ascorbate biosynthesis, animals, glucose-1P => ascorbate |
ko05204 | Chemical carcinogenesis |
rno05204 | Chemical carcinogenesis |
ko00982 | Drug metabolism - cytochrome P450 |
rno00982 | Drug metabolism - cytochrome P450 |
ko00983 | Drug metabolism - other enzymes |
rno00983 | Drug metabolism - other enzymes |
M00014 | Glucuronate pathway (uronate pathway) |
rno01100 | Metabolic pathways |
ko00980 | Metabolism of xenobiotics by cytochrome P450 |
rno00980 | Metabolism of xenobiotics by cytochrome P450 |
ko00040 | Pentose and glucuronate interconversions |
rno00040 | Pentose and glucuronate interconversions |
ko00860 | Porphyrin and chlorophyll metabolism |
rno00860 | Porphyrin and chlorophyll metabolism |
ko00830 | Retinol metabolism |
rno00830 | Retinol metabolism |
ko00500 | Starch and sucrose metabolism |
rno00500 | Starch and sucrose metabolism |
ko00140 | Steroid hormone biosynthesis |
rno00140 | Steroid hormone biosynthesis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002213 | UDP-glucuronosyl/UDP-glucosyltransferase |
UniProt Annotations
Entry Information
Gene Name
UDP glucuronosyltransferase 2 family, polypeptide B10
Protein Entry
D4A132_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data |
Similarity | Belongs to the UDP-glycosyltransferase family |
Identical and Related Proteins
Unique RefSeq proteins for LMP013254 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
300794198 | RefSeq | NP_001178605 | 532 | UDP-glucuronosyltransferase 2B10 precursor |
Identical Sequences to LMP013254 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP013254 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:300794198 | GenBank | AAH28826.1 | 532 | UDP glucuronosyltransferase 2 family, polypeptide B34 [Mus musculus] |
GI:300794198 | GenBank | EDL37970.1 | 532 | UDP glucuronosyltransferase 2 family, polypeptide B34 [Mus musculus] |
GI:300794198 | RefSeq | NP_705826.1 | 532 | UDP-glucuronosyltransferase 2B10 precursor [Mus musculus] |
GI:300794198 | RefSeq | XP_006250871.1 | 530 | PREDICTED: UDP-glucuronosyltransferase 2B31-like isoform X1 [Rattus norvegicus] |