Gene/Proteome Database (LMPD)

LMPD ID
LMP013258
Gene ID
305348
Species
Rattus norvegicus (Rat)
Gene Name
lipoic acid synthetase
Gene Symbol
Lias
Alternate Names
lipoyl synthase, mitochondrial; LS {ECO:0000255|HAMAP-Rule:MF_03123}; lip-syn {ECO:0000255|HAMAP-Rule:MF_03123}; lipoate synthase {ECO:0000255|HAMAP-Rule:MF_03123}; lipoic acid synthase {ECO:0000255|HAMAP-Rule:MF_03123}; lipoyl synthase, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03123};
Chromosome
14
Map Location
14p11
EC Number
2.8.1.8

Proteins

lipoyl synthase, mitochondrial precursor
Refseq ID NP_001012037
Protein GI 58865650
UniProt ID Q5XIH4
mRNA ID NM_001012037
Length 373
MALRCWDAARSLGSRIFGRYACSVRALSSLPDEKKKFLHNGPDLQDFVSGDLADKSTWDDYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDPSEPDNTARAIAEWGLDYVVLTSVDRDDVVDGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVQPDVVSKTSIMLGLGETDEQVYATMKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEEVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKVSKV
transit_peptide: 1..26 experiment: experimental evidence, no additional details recorded note: Mitochondrion. {ECO:0000255|HAMAP-Rule:MF_03123}; propagated from UniProtKB/Swiss-Prot (Q5XIH4.1) calculated_mol_wt: 2917 peptide sequence: MALRCWDAARSLGSRIFGRYACSVRA mat_peptide: 27..373 product: Lipoyl synthase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q5XIH4.1) calculated_mol_wt: 38975 peptide sequence: LSSLPDEKKKFLHNGPDLQDFVSGDLADKSTWDDYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDPSEPDNTARAIAEWGLDYVVLTSVDRDDVVDGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVQPDVVSKTSIMLGLGETDEQVYATMKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEEVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKVSKV

Gene Information

Entrez Gene ID
305348
Gene Name
lipoic acid synthetase
Gene Symbol
Lias
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:UniProtKB-HAMAP C mitochondrion
GO:0051539 IEA:UniProtKB-HAMAP F 4 iron, 4 sulfur cluster binding
GO:0016992 IEA:UniProtKB-HAMAP F lipoate synthase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0006954 IEA:Ensembl P inflammatory response
GO:0001843 IEA:Ensembl P neural tube closure
GO:0009249 IEA:UniProtKB-HAMAP P protein lipoylation
GO:0032496 IEA:Ensembl P response to lipopolysaccharide
GO:0006979 IEA:Ensembl P response to oxidative stress

KEGG Pathway Links

KEGG Pathway ID Description
ko00785 Lipoic acid metabolism
rno00785 Lipoic acid metabolism
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR013785 Aldolase-type TIM barrel
IPR006638 Elongator protein 3/MiaB/NifB
IPR003698 Lipoyl synthase
IPR007197 Radical SAM

UniProt Annotations

Entry Information

Gene Name
lipoic acid synthetase
Protein Entry
LIAS_RAT
UniProt ID
Q5XIH4
Species
Rat

Comments

Comment Type Description
Catalytic Activity Protein N(6)-(octanoyl)lysine + 2 sulfur- (sulfur carrier) + 2 S-adenosyl-L-methionine = protein N(6)- (lipoyl)lysine + 2 (sulfur carrier) + 2 L-methionine + 2 5'- deoxyadenosine.
Cofactor Name=[4Fe-4S] cluster; Xref=ChEBI:CHEBI:49883; Evidence= ; Note=Binds 2 [4Fe-4S] clusters per subunit. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L- methionine. ;
Function Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives
Pathway Protein modification; protein lipoylation via endogenous pathway; protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier- protein]: step 2/2
Similarity Belongs to the radical SAM superfamily. Lipoyl synthase family
Subcellular Location Mitochondrion {ECO:0000255|HAMAP- Rule:MF_03123}.

Identical and Related Proteins

Unique RefSeq proteins for LMP013258 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58865650 RefSeq NP_001012037 373 lipoyl synthase, mitochondrial precursor

Identical Sequences to LMP013258 proteins

Reference Database Accession Length Protein Name
GI:58865650 EMBL CBN72402.1 373 unnamed protein product [Rattus norvegicus]
GI:58865650 GenBank AAH83708.1 373 Lipoic acid synthetase [Rattus norvegicus]
GI:58865650 SwissProt Q5XIH4.1 373 RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP013258 proteins

Reference Database Accession Length Protein Name
GI:58865650 DBBJ BAC33443.1 373 unnamed protein product [Mus musculus]
GI:58865650 EMBL CBN72402.1 373 unnamed protein product [Rattus norvegicus]
GI:58865650 GenBank AAH83708.1 373 Lipoic acid synthetase [Rattus norvegicus]
GI:58865650 SwissProt Q5XIH4.1 373 RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor [Rattus norvegicus]