Gene/Proteome Database (LMPD)

LMPD ID
LMP013286
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 1, member C1
Gene Symbol
Synonyms
Akr1c6; Hsd17b5;
Alternate Names
aldo-keto reductase family 1, member C1; aldo-keto reductase family 1, member C6; type 5 17beta-hydroxysteroid dehydrogenase; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase); aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase);
Chromosome
17
Map Location
17q12.3
EC Number
1.1.1.62

Proteins

aldo-keto reductase family 1, member C1
Refseq ID NP_001028869
Protein GI 76096330
UniProt ID Q3MHS3
mRNA ID NM_001033697
Length 323
MNSKQQTVRLSDGHFIPVLGFGTYAPREVPKSKALEATKIAIDAGFRHIDSAAVYQNEKEVGLAIRSKIADGTVKREDIFYTSKVWCTFNHPERVQVCLEQSLKQLQLEYVDLYLIHFPMALKPEEDLKAKDENEKLLFDVVDICDTWKAMEKCKDAGLAKSIGVSNFNRRQLEKILNKPGLKHRPVCNQVECHPYLNQRKLLDFCKSKDIVLVAYSALGSHRETRCVDKSLPVLLADPVLCAIAKKYNWTPALIALRYQLERGVVVLAKSFTEKRIKENMQVFEFQLTSEDMKVLDGLNKNIRYMSGSRFQGHPDFPFLDEY

Gene Information

Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member C1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0005634 IDA:UniProtKB C nucleus
GO:0047006 IDA:RGD F 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity
GO:0004303 IEA:UniProtKB-EC F estradiol 17-beta-dehydrogenase activity
GO:0047045 IDA:RGD F testosterone 17-beta-dehydrogenase (NADP+) activity
GO:0042493 IDA:RGD P response to drug
GO:0043627 IDA:RGD P response to estrogen

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953720 Bile acid and bile salt metabolism
5953253 Disease
5953382 Diseases associated with visual transduction
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954392 Retinoid metabolism and transport
5953381 Signal Transduction
5953492 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
5953930 Synthesis of bile acids and bile salts
5953933 Synthesis of bile acids and bile salts via 24-hydroxycholesterol
5953929 Synthesis of bile acids and bile salts via 27-hydroxycholesterol
5953931 Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member C1
Protein Entry
Q3MHS3_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013286 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
76096330 RefSeq NP_001028869 323 aldo-keto reductase family 1, member C1

Identical Sequences to LMP013286 proteins

Reference Database Accession Length Protein Name
GI:76096330 DBBJ BAF56209.1 323 type 5 17beta-hydroxysteroid dehydrogenase [Rattus norvegicus]
GI:76096330 GenBank AAI04717.1 323 Aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) [Rattus norvegicus]

Related Sequences to LMP013286 proteins

Reference Database Accession Length Protein Name
GI:76096330 DBBJ BAF56209.1 323 type 5 17beta-hydroxysteroid dehydrogenase [Rattus norvegicus]
GI:76096330 GenBank AAH88227.1 322 Akr1c1 protein, partial [Rattus norvegicus]
GI:76096330 GenBank AAI04717.1 323 Aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) [Rattus norvegicus]
GI:76096330 RefSeq XP_006254250.1 287 PREDICTED: aldo-keto reductase family 1, member C1 isoform X1 [Rattus norvegicus]