Gene/Proteome Database (LMPD)
LMPD ID
LMP013345
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
paraoxonase 3
Gene Symbol
Alternate Names
serum paraoxonase/lactonase 3;
Chromosome
4
Map Location
4q13
EC Number
3.1.1.2
Summary
microsomal paraoxonase that has esterase activity on a broad range of substrates [RGD, Feb 2006]
Orthologs
Proteins
| serum paraoxonase/lactonase 3 precursor | |
|---|---|
| Refseq ID | NP_001004086 |
| Protein GI | 51854237 |
| UniProt ID | Q68FP2 |
| mRNA ID | NM_001004086 |
| Length | 354 |
| MGKLVALTVLGASLALLGERLLNFRERVSTSREIKPTEPQNCHLIEGLENGSEDIDILPSGLAFISTGLKYPGMPSFAPDKPGRIFLMDLNEPYPKAQALEISDGFDQDSLNPHGISTFIDKDNTVYLYAVNHPHMDSTVEIFKFEEQPRSLVHLKTIKHELFESVNDIVVLGPEQFYATRDHYFTSHFLVLLEMILDPHWTSVLFYSPKEVKVVAQGFSSANGITVSLDQKYVYVADVTAKNIHIMKKHNNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVLRIQDPLSDNPRVSTLYSNNGSVLQGSTVASVYHKKMLIGTIFHKALYCEL | |
| sig_peptide: 1..15 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1444 peptide sequence: MGKLVALTVLGASLA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005615 | IMP:RGD | C | extracellular space |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0043231 | IDA:RGD | C | intracellular membrane-bounded organelle |
| GO:0018733 | IDA:RGD | F | 3,4-dihydrocoumarin hydrolase activity |
| GO:0004063 | IEA:UniProtKB-EC | F | aryldialkylphosphatase activity |
| GO:0004064 | IDA:RGD | F | arylesterase activity |
| GO:0047856 | IDA:RGD | F | dihydrocoumarin hydrolase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0046226 | IDA:RGD | P | coumarin catabolic process |
| GO:0010124 | IDA:RGD | P | phenylacetate catabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| rno01100 | Metabolic pathways |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A phenyl acetate + H(2)O = a phenol + acetate. |
| Catalytic Activity | An N-acyl-L-homoserine lactone + H(2)O = an N- acyl-L-homoserine. |
| Catalytic Activity | An aryl dialkyl phosphate + H(2)O = dialkyl phosphate + an aryl alcohol. |
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence= ; Note=Binds 2 calcium ions per subunit. ; |
| Function | Has low activity towards the organophosphate paraxon and aromatic carboxylic acid esters. Rapidly hydrolyzes lactones such as statin prodrugs (e.g. lovastatin). Hydrolyzes aromatic lactones and 5- or 6-member ring lactones with aliphatic substituents but not simple lactones or those with polar substituents (By similarity) |
| Ptm | Glycosylated |
| Ptm | The signal sequence is not cleaved |
| Similarity | Belongs to the paraoxonase family |
| Subcellular Location | Secreted, extracellular space . |
| Subunit | Homodimer |
Identical and Related Proteins
Unique RefSeq proteins for LMP013345 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 51854237 | RefSeq | NP_001004086 | 354 | serum paraoxonase/lactonase 3 precursor |
Identical Sequences to LMP013345 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:51854237 | GenBank | AAH79466.1 | 354 | Paraoxonase 3 [Rattus norvegicus] |
| GI:51854237 | GenBank | EDM15021.1 | 354 | paraoxonase 3, isoform CRA_b [Rattus norvegicus] |
| GI:51854237 | SwissProt | Q68FP2.1 | 354 | RecName: Full=Serum paraoxonase/lactonase 3 [Rattus norvegicus] |
Related Sequences to LMP013345 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:51854237 | GenBank | AAH79466.1 | 354 | Paraoxonase 3 [Rattus norvegicus] |
| GI:51854237 | GenBank | EDM15021.1 | 354 | paraoxonase 3, isoform CRA_b [Rattus norvegicus] |
| GI:51854237 | GenBank | ADL98070.1 | 354 | Sequence 11 from patent US 7718773 |
| GI:51854237 | SwissProt | Q68FP2.1 | 354 | RecName: Full=Serum paraoxonase/lactonase 3 [Rattus norvegicus] |