Gene/Proteome Database (LMPD)

LMPD ID
LMP013359
Gene ID
313536
Species
Rattus norvegicus (Rat)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Gene Symbol
B4galt2
Alternate Names
beta-1,4-galactosyltransferase 2;
Chromosome
5
Map Location
5q36

Proteins

beta-1,4-galactosyltransferase 2
Refseq ID NP_001101435
Protein GI 157818359
UniProt ID D4A2A5
mRNA ID NM_001107965
Length 369
MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSTRSPAHALYPAASSSTNCSRPNTTAASSGLPEVPSARPGPTAPVIPPCPDVPPGLVGRVVIEFTSPMPLERVQRENPGVLLGGRYSPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQHGEETFNRAKLLNVGFLEALKEDATYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYASYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDVRIGRYRMIKHDRDKHNEPNPQRFNKIQNTKMSMKWDGIGSVRYRVLEVSRQPLFTNITVDIGQPMSWLTQG

Gene Information

Entrez Gene ID
313536
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Gene Symbol
B4galt2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016757 IEA:UniProtKB-KW F transferase activity, transferring glycosyl groups
GO:0005975 IEA:InterPro P carbohydrate metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00052 Galactose metabolism
rno00052 Galactose metabolism
ko00533 Glycosaminoglycan biosynthesis - keratan sulfate
rno00533 Glycosaminoglycan biosynthesis - keratan sulfate
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
M00071 Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
rno01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
rno00510 N-Glycan biosynthesis
M00075 N-glycan biosynthesis, complex type
ko00514 Other types of O-glycan biosynthesis
rno00514 Other types of O-glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953253 Disease
5953252 Glycogen storage diseases
5953861 Glycosaminoglycan metabolism
5954344 Keratan sulfate biosynthesis
5954345 Keratan sulfate/keratin metabolism
5953870 MPS I - Hurler syndrome
5953869 MPS II - Hunter syndrome
5953872 MPS IIIA - Sanfilippo syndrome A
5953864 MPS IIIB - Sanfilippo syndrome B
5953867 MPS IIIC - Sanfilippo syndrome C
5953871 MPS IIID - Sanfilippo syndrome D
5953866 MPS IV - Morquio syndrome A
5953873 MPS IV - Morquio syndrome B
5953862 MPS IX - Natowicz syndrome
5953865 MPS VI - Maroteaux-Lamy syndrome
5953868 MPS VII - Sly syndrome
5953250 Metabolism
5953249 Metabolism of carbohydrates
5953345 Metabolism of proteins
5953863 Mucopolysaccharidoses
5953251 Myoclonic epilepsy of Lafora
5954395 N-Glycan antennae elongation
5954394 N-glycan antennae elongation in the medial/trans-Golgi
5953728 Post-translational protein modification
5954050 Transport to the Golgi and subsequent modification

Domain Information

InterPro Annotations

Accession Description
IPR003859 Beta-1,4-galactosyltransferase
IPR027791 Galactosyltransferase, C-terminal
IPR027995 Galactosyltransferase, N-terminal
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Protein Entry
D4A2A5_RAT
UniProt ID
D4A2A5
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013359 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157818359 RefSeq NP_001101435 369 beta-1,4-galactosyltransferase 2

Identical Sequences to LMP013359 proteins

Reference Database Accession Length Protein Name
GI:157818359 GenBank EDL90204.1 369 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (predicted) [Rattus norvegicus]
GI:157818359 RefSeq XP_006238729.1 369 PREDICTED: beta-1,4-galactosyltransferase 2 isoform X1 [Rattus norvegicus]

Related Sequences to LMP013359 proteins

Reference Database Accession Length Protein Name
GI:157818359 DBBJ BAA34385.1 369 beta-1,4-galactosyltransferase II [Mus musculus]
GI:157818359 GenBank AAF22220.1 369 beta-1,4-galactosyltransferase II [Mus musculus]
GI:157818359 GenBank EDL90204.1 369 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (predicted) [Rattus norvegicus]
GI:157818359 RefSeq XP_006238729.1 369 PREDICTED: beta-1,4-galactosyltransferase 2 isoform X1 [Rattus norvegicus]