Gene/Proteome Database (LMPD)

LMPD ID
LMP013405
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
sialidase 4
Gene Symbol
Alternate Names
sialidase-4; neuraminidase 4;
Chromosome
9
Map Location
9q36

Proteins

sialidase-4
Refseq ID NP_001101704
Protein GI 157817843
UniProt ID D3ZWB7
mRNA ID NM_001108234
Length 478
MGPAHVPKRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGVLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVRGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGRICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFPAPPSIGPQDDRWLASPGNTPHSPCFDLRVRESLAEGARGFVEGWASRLLLCYPQSRGPENHGLEPGPDGEKTSWSPELPMSSASVRQSSTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWIIYEGPSGYSDLAFLGPVPGASLAFACLFESGTRASYEDISFCLFSLADVLENVPTGLEISSLRNKPQGHCWPS

Gene Information

Entrez Gene ID
Gene Name
sialidase 4
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005764 IEA:Ensembl C lysosome
GO:0005739 IEA:Ensembl C mitochondrion
GO:0019866 IEA:Ensembl C organelle inner membrane
GO:0004308 IEA:Ensembl F exo-alpha-sialidase activity
GO:0006689 IEA:Ensembl P ganglioside catabolic process
GO:0006516 IEA:Ensembl P glycoprotein catabolic process
GO:0009313 IEA:Ensembl P oligosaccharide catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00511 Other glycan degradation
rno00511 Other glycan degradation
ko00600 Sphingolipid metabolism
rno00600 Sphingolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953739 Asparagine N-linked glycosylation
5953738 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
5954485 Glycosphingolipid metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953345 Metabolism of proteins
5953728 Post-translational protein modification
5954270 Sialic acid metabolism
5954267 Sphingolipid metabolism
5953737 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR026856 Sialidase family
IPR026946 Sialidase-4
IPR011040 Sialidases

UniProt Annotations

Entry Information

Gene Name
sialidase 4
Protein Entry
D3ZWB7_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013405 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157817843 RefSeq NP_001101704 478 sialidase-4

Identical Sequences to LMP013405 proteins

Reference Database Accession Length Protein Name
GI:157817843 GenBank EDL91894.1 478 sialidase 4 (predicted) [Rattus norvegicus]
GI:157817843 RefSeq XP_008765616.1 478 PREDICTED: sialidase-4 isoform X2 [Rattus norvegicus]

Related Sequences to LMP013405 proteins

Reference Database Accession Length Protein Name
GI:157817843 GenBank EDL91894.1 478 sialidase 4 (predicted) [Rattus norvegicus]
GI:157817843 RefSeq XP_006245597.1 505 PREDICTED: sialidase-4 isoform X1 [Rattus norvegicus]
GI:157817843 RefSeq XP_008765598.1 505 PREDICTED: sialidase-4 isoform X1 [Rattus norvegicus]
GI:157817843 RefSeq XP_008765616.1 478 PREDICTED: sialidase-4 isoform X2 [Rattus norvegicus]