Gene/Proteome Database (LMPD)
Proteins
| sialidase-4 | |
|---|---|
| Refseq ID | NP_001101704 |
| Protein GI | 157817843 |
| UniProt ID | D3ZWB7 |
| mRNA ID | NM_001108234 |
| Length | 478 |
| MGPAHVPKRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGVLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVRGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGRICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFPAPPSIGPQDDRWLASPGNTPHSPCFDLRVRESLAEGARGFVEGWASRLLLCYPQSRGPENHGLEPGPDGEKTSWSPELPMSSASVRQSSTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWIIYEGPSGYSDLAFLGPVPGASLAFACLFESGTRASYEDISFCLFSLADVLENVPTGLEISSLRNKPQGHCWPS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005764 | IEA:Ensembl | C | lysosome |
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0019866 | IEA:Ensembl | C | organelle inner membrane |
| GO:0004308 | IEA:Ensembl | F | exo-alpha-sialidase activity |
| GO:0006689 | IEA:Ensembl | P | ganglioside catabolic process |
| GO:0006516 | IEA:Ensembl | P | glycoprotein catabolic process |
| GO:0009313 | IEA:Ensembl | P | oligosaccharide catabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00511 | Other glycan degradation |
| rno00511 | Other glycan degradation |
| ko00600 | Sphingolipid metabolism |
| rno00600 | Sphingolipid metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953739 | Asparagine N-linked glycosylation |
| 5953738 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
| 5954485 | Glycosphingolipid metabolism |
| 5953250 | Metabolism |
| 5953289 | Metabolism of lipids and lipoproteins |
| 5953345 | Metabolism of proteins |
| 5953728 | Post-translational protein modification |
| 5954270 | Sialic acid metabolism |
| 5954267 | Sphingolipid metabolism |
| 5953737 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013405 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157817843 | RefSeq | NP_001101704 | 478 | sialidase-4 |
Identical Sequences to LMP013405 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157817843 | GenBank | EDL91894.1 | 478 | sialidase 4 (predicted) [Rattus norvegicus] |
| GI:157817843 | RefSeq | XP_008765616.1 | 478 | PREDICTED: sialidase-4 isoform X2 [Rattus norvegicus] |
Related Sequences to LMP013405 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157817843 | GenBank | EDL91894.1 | 478 | sialidase 4 (predicted) [Rattus norvegicus] |
| GI:157817843 | RefSeq | XP_006245597.1 | 505 | PREDICTED: sialidase-4 isoform X1 [Rattus norvegicus] |
| GI:157817843 | RefSeq | XP_008765598.1 | 505 | PREDICTED: sialidase-4 isoform X1 [Rattus norvegicus] |
| GI:157817843 | RefSeq | XP_008765616.1 | 478 | PREDICTED: sialidase-4 isoform X2 [Rattus norvegicus] |