Gene/Proteome Database (LMPD)
Proteins
sialidase-4 | |
---|---|
Refseq ID | NP_001101704 |
Protein GI | 157817843 |
UniProt ID | D3ZWB7 |
mRNA ID | NM_001108234 |
Length | 478 |
MGPAHVPKRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGVLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVRGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGRICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFPAPPSIGPQDDRWLASPGNTPHSPCFDLRVRESLAEGARGFVEGWASRLLLCYPQSRGPENHGLEPGPDGEKTSWSPELPMSSASVRQSSTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWIIYEGPSGYSDLAFLGPVPGASLAFACLFESGTRASYEDISFCLFSLADVLENVPTGLEISSLRNKPQGHCWPS |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005764 | IEA:Ensembl | C | lysosome |
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0019866 | IEA:Ensembl | C | organelle inner membrane |
GO:0004308 | IEA:Ensembl | F | exo-alpha-sialidase activity |
GO:0006689 | IEA:Ensembl | P | ganglioside catabolic process |
GO:0006516 | IEA:Ensembl | P | glycoprotein catabolic process |
GO:0009313 | IEA:Ensembl | P | oligosaccharide catabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00511 | Other glycan degradation |
rno00511 | Other glycan degradation |
ko00600 | Sphingolipid metabolism |
rno00600 | Sphingolipid metabolism |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5953739 | Asparagine N-linked glycosylation |
5953738 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
5954485 | Glycosphingolipid metabolism |
5953250 | Metabolism |
5953289 | Metabolism of lipids and lipoproteins |
5953345 | Metabolism of proteins |
5953728 | Post-translational protein modification |
5954270 | Sialic acid metabolism |
5954267 | Sphingolipid metabolism |
5953737 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013405 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157817843 | RefSeq | NP_001101704 | 478 | sialidase-4 |
Identical Sequences to LMP013405 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157817843 | GenBank | EDL91894.1 | 478 | sialidase 4 (predicted) [Rattus norvegicus] |
GI:157817843 | RefSeq | XP_008765616.1 | 478 | PREDICTED: sialidase-4 isoform X2 [Rattus norvegicus] |
Related Sequences to LMP013405 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157817843 | GenBank | EDL91894.1 | 478 | sialidase 4 (predicted) [Rattus norvegicus] |
GI:157817843 | RefSeq | XP_006245597.1 | 505 | PREDICTED: sialidase-4 isoform X1 [Rattus norvegicus] |
GI:157817843 | RefSeq | XP_008765598.1 | 505 | PREDICTED: sialidase-4 isoform X1 [Rattus norvegicus] |
GI:157817843 | RefSeq | XP_008765616.1 | 478 | PREDICTED: sialidase-4 isoform X2 [Rattus norvegicus] |