Gene/Proteome Database (LMPD)
LMPD ID
LMP013415
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
carbonyl reductase 4
Gene Symbol
Alternate Names
carbonyl reductase family member 4; carbonic reductase 4; quinone reductase CBR4; 3-oxoacyl-[acyl-carrier-protein] reductase;
Chromosome
16
Map Location
16p12
EC Number
1.-.-.-
Proteins
carbonyl reductase family member 4 | |
---|---|
Refseq ID | NP_872613 |
Protein GI | 32996723 |
UniProt ID | Q7TS56 |
mRNA ID | NM_182672 |
Length | 236 |
MDKVCAVFGGSRGIGKAVAQLMAQKGYRLAIVARNLEVAKATASELGGIHLAFRCNIAKEGDVHSTFEEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQGGSIVNVGSIIGLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHLKEEHFKKNIPLGRFGEALEVAHAVVFLLESPYITGHVLIVDGGLQLTA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005759 | ISS:UniProtKB | C | mitochondrial matrix |
GO:0070402 | ISS:UniProtKB | F | NADPH binding |
GO:0008753 | ISS:UniProtKB | F | NADPH dehydrogenase (quinone) activity |
GO:0048038 | ISS:UniProtKB | F | quinone binding |
GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | The heteroteramer with HSD17B8 has NADH-dependent 3- ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria. The homotetramer may act as NADPH-dependent quinone reductase. Has broad substrate specificity and reduces 9,10-phenanthrenequinone, 1,4-benzoquinone and various other o-quinones and p-quinones (in vitro) (By similarity) |
Pathway | Lipid metabolism; fatty acid biosynthesis. |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
Subcellular Location | Mitochondrion matrix . |
Subunit | Homotetramer. Heterotetramer with HSD17B8; contains two molecules of HSD17B8 and CBR4 (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP013415 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
32996723 | RefSeq | NP_872613 | 236 | carbonyl reductase family member 4 |
Identical Sequences to LMP013415 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:32996723 | EMBL | CBF61552.1 | 236 | unnamed protein product [Rattus norvegicus] |
GI:32996723 | EMBL | CBU86504.1 | 236 | unnamed protein product [Rattus norvegicus] |
GI:32996723 | GenBank | EDL87203.1 | 236 | carbonic reductase 4, isoform CRA_a [Rattus norvegicus] |
GI:32996723 | GenBank | AGX53389.1 | 236 | Sequence 7147 from patent US 8541208 |
Related Sequences to LMP013415 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:32996723 | EMBL | CBF61552.1 | 236 | unnamed protein product [Rattus norvegicus] |
GI:32996723 | EMBL | CBU86504.1 | 236 | unnamed protein product [Rattus norvegicus] |
GI:32996723 | GenBank | AGX53389.1 | 236 | Sequence 7147 from patent US 8541208 |
GI:32996723 | SwissProt | Q7TS56.1 | 236 | RecName: Full=Carbonyl reductase family member 4; AltName: Full=3-oxoacyl-[acyl-carrier-protein] reductase; AltName: Full=Quinone reductase CBR4 [Rattus norvegicus] |