Gene/Proteome Database (LMPD)

LMPD ID
LMP013426
Gene ID
361071
Species
Rattus norvegicus (Rat)
Gene Name
succinate-CoA ligase, ADP-forming, beta subunit
Gene Symbol
Sucla2
Alternate Names
succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial; succinate-Coenzyme A ligase, ADP-forming, beta subunit;
Chromosome
15
Map Location
15p11-q11

Proteins

succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
Refseq ID NP_001101857
Protein GI 158749584
UniProt ID F1LM47
mRNA ID NM_001108387
Length 465
MAASMFFGRQLAAAALRSHRSQTTVRATAQALGSSGLFNKHGFQMQQQQQQQRSLSLHEYLSMELLQEAGVSVPKGFVAKSSDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFTSGLKGGVKIVFSPEEAKAVSSQMIGQKLITKQTGAKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSQGGVNIEDVAAENPEAIVKEPVDIIEGVKKEQAVTLAKKMGFPSNIVDSAAENMIKLYNLFLKYDATMVEINPMVEDADGKVLCMDAKINFDSNSAYRQKKIFALQDWSQEDERDKDAADADINYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVHQVTEAFKLITSDKRVQAILVNIFGGIMRCDIIAQGIVMAVKDLEIRIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAAKMVVKLSEIVTLAKEAHVDVKFQLPI

Gene Information

Entrez Gene ID
361071
Gene Name
succinate-CoA ligase, ADP-forming, beta subunit
Gene Symbol
Sucla2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005739 IDA:RGD C mitochondrion
GO:0005524 IEA:InterPro F ATP binding
GO:0046872 IEA:InterPro F metal ion binding
GO:0004775 IDA:RGD F succinate-CoA ligase (ADP-forming) activity
GO:0006105 IDA:RGD P succinate metabolic process
GO:0006104 IDA:RGD P succinyl-CoA metabolic process
GO:0006099 IDA:RGD P tricarboxylic acid cycle

KEGG Pathway Links

KEGG Pathway ID Description
ko01200 Carbon metabolism
rno01200 Carbon metabolism
ko00020 Citrate cycle (TCA cycle)
rno00020 Citrate cycle (TCA cycle)
M00009 Citrate cycle (TCA cycle, Krebs cycle)
M00011 Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno01100 Metabolic pathways
ko00640 Propanoate metabolism
rno00640 Propanoate metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953285 Citric acid cycle (TCA cycle)
5953250 Metabolism
5953269 Pyruvate metabolism and Citric Acid (TCA) cycle
5953270 The citric acid (TCA) cycle and respiratory electron transport

Domain Information

InterPro Annotations

Accession Description
IPR005811 ATP-citrate lyase/succinyl-CoA ligase
IPR011761 ATP-grasp fold
IPR013815 ATP-grasp fold, subdomain 1
IPR013816 ATP-grasp fold, subdomain 2
IPR013650 ATP-grasp fold, succinyl-CoA synthetase-type
IPR005809 Succinyl-CoA synthetase, beta subunit
IPR017866 Succinyl-CoA synthetase, beta subunit, conserved site
IPR016102 Succinyl-CoA synthetase-like

UniProt Annotations

Entry Information

Gene Name
succinate-CoA ligase, ADP-forming, beta subunit
Protein Entry
F1LM47_RAT
UniProt ID
F1LM47
Species
Rat

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data
Similarity Belongs to the succinate/malate CoA ligase beta subunit family

Identical and Related Proteins

Unique RefSeq proteins for LMP013426 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
158749584 RefSeq NP_001101857 465 succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial

Identical Sequences to LMP013426 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP013426 proteins

Reference Database Accession Length Protein Name
GI:158749584 DBBJ BAE35942.1 463 unnamed protein product [Mus musculus]
GI:158749584 DBBJ BAE21343.1 463 unnamed protein product [Mus musculus]
GI:158749584 DBBJ BAE35647.1 463 unnamed protein product [Mus musculus]
GI:158749584 GenBank AAH57605.1 463 Succinate-Coenzyme A ligase, ADP-forming, beta subunit [Mus musculus]