Gene/Proteome Database (LMPD)

LMPD ID
LMP013459
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Gene Symbol
Synonyms
Ke6; Fabgl; RING2;
Alternate Names
estradiol 17-beta-dehydrogenase 8; 17-beta-HSD 8; testosterone 17-beta-dehydrogenase 8; 17-beta-hydroxysteroid dehydrogenase 8; 3-oxoacyl-[acyl-carrier-protein] reductase;
Chromosome
20
Map Location
20p12
EC Number
1.1.1.62

Proteins

estradiol 17-beta-dehydrogenase 8
Refseq ID NP_997694
Protein GI 47087119
UniProt ID Q6MGB5
mRNA ID NM_212529
Length 259
MASQLRLRSALALVTGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGNPGSEDREPRGKHAAFQADVSEGPAAKRLLEQVQACFFRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALVSSGGRGSIINISSIVGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKMPEKVKDKVTAMIPLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGGLFM

Gene Information

Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005740 IEA:Ensembl C mitochondrial envelope
GO:0005759 IEA:Ensembl C mitochondrial matrix
GO:0005886 IEA:Ensembl C plasma membrane
GO:0003857 IEA:Ensembl F 3-hydroxyacyl-CoA dehydrogenase activity
GO:0004303 ISS:UniProtKB F estradiol 17-beta-dehydrogenase activity
GO:0047035 IEA:UniProtKB-EC F testosterone dehydrogenase (NAD+) activity
GO:0008209 IEA:Ensembl P androgen metabolic process
GO:0006703 ISS:UniProtKB P estrogen biosynthetic process
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Protein Entry
DHB8_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H.
Catalytic Activity Testosterone + NAD(+) = androstenedione + NADH.
Function NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone (By similarity). The heteroteramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria (By similarity)
Pathway Lipid metabolism; fatty acid biosynthesis.
Pathway Steroid biosynthesis; estrogen biosynthesis.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family
Subcellular Location Mitochondrion matrix .
Subunit Heterotetramer with CBR4; contains two molecules of HSD17B8 and CBR4

Identical and Related Proteins

Unique RefSeq proteins for LMP013459 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
47087119 RefSeq NP_997694 259 estradiol 17-beta-dehydrogenase 8

Identical Sequences to LMP013459 proteins

Reference Database Accession Length Protein Name
GI:47087119 EMBL CBF61750.1 259 unnamed protein product [Rattus norvegicus]
GI:47087119 EMBL CBU86626.1 259 unnamed protein product [Rattus norvegicus]
GI:47087119 GenBank EDL96829.1 259 hydroxysteroid (17-beta) dehydrogenase 8, isoform CRA_c [Rattus norvegicus]
GI:47087119 GenBank AGX53512.1 259 Sequence 7393 from patent US 8541208

Related Sequences to LMP013459 proteins

Reference Database Accession Length Protein Name
GI:47087119 EMBL CBF61750.1 259 unnamed protein product [Rattus norvegicus]
GI:47087119 EMBL CBU86626.1 259 unnamed protein product [Rattus norvegicus]
GI:47087119 GenBank AGX53512.1 259 Sequence 7393 from patent US 8541208
GI:47087119 SwissProt Q6MGB5.1 259 RecName: Full=Estradiol 17-beta-dehydrogenase 8; AltName: Full=17-beta-hydroxysteroid dehydrogenase 8; Short=17-beta-HSD 8; AltName: Full=3-oxoacyl-[acyl-carrier-protein] reductase; AltName: Full=Testosterone 17-beta-dehydrogenase 8 [Rattus norvegicus]