Gene/Proteome Database (LMPD)
LMPD ID
LMP013459
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Gene Symbol
Synonyms
Ke6; Fabgl; RING2;
Alternate Names
estradiol 17-beta-dehydrogenase 8; 17-beta-HSD 8; testosterone 17-beta-dehydrogenase 8; 17-beta-hydroxysteroid dehydrogenase 8; 3-oxoacyl-[acyl-carrier-protein] reductase;
Chromosome
20
Map Location
20p12
EC Number
1.1.1.62
Proteins
| estradiol 17-beta-dehydrogenase 8 | |
|---|---|
| Refseq ID | NP_997694 |
| Protein GI | 47087119 |
| UniProt ID | Q6MGB5 |
| mRNA ID | NM_212529 |
| Length | 259 |
| MASQLRLRSALALVTGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGNPGSEDREPRGKHAAFQADVSEGPAAKRLLEQVQACFFRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALVSSGGRGSIINISSIVGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKMPEKVKDKVTAMIPLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGGLFM | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005740 | IEA:Ensembl | C | mitochondrial envelope |
| GO:0005759 | IEA:Ensembl | C | mitochondrial matrix |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0003857 | IEA:Ensembl | F | 3-hydroxyacyl-CoA dehydrogenase activity |
| GO:0004303 | ISS:UniProtKB | F | estradiol 17-beta-dehydrogenase activity |
| GO:0047035 | IEA:UniProtKB-EC | F | testosterone dehydrogenase (NAD+) activity |
| GO:0008209 | IEA:Ensembl | P | androgen metabolic process |
| GO:0006703 | ISS:UniProtKB | P | estrogen biosynthetic process |
| GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Protein Entry
DHB8_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. |
| Catalytic Activity | Testosterone + NAD(+) = androstenedione + NADH. |
| Function | NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone (By similarity). The heteroteramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria (By similarity) |
| Pathway | Lipid metabolism; fatty acid biosynthesis. |
| Pathway | Steroid biosynthesis; estrogen biosynthesis. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
| Subcellular Location | Mitochondrion matrix . |
| Subunit | Heterotetramer with CBR4; contains two molecules of HSD17B8 and CBR4 |
Identical and Related Proteins
Unique RefSeq proteins for LMP013459 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 47087119 | RefSeq | NP_997694 | 259 | estradiol 17-beta-dehydrogenase 8 |
Identical Sequences to LMP013459 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47087119 | EMBL | CBF61750.1 | 259 | unnamed protein product [Rattus norvegicus] |
| GI:47087119 | EMBL | CBU86626.1 | 259 | unnamed protein product [Rattus norvegicus] |
| GI:47087119 | GenBank | EDL96829.1 | 259 | hydroxysteroid (17-beta) dehydrogenase 8, isoform CRA_c [Rattus norvegicus] |
| GI:47087119 | GenBank | AGX53512.1 | 259 | Sequence 7393 from patent US 8541208 |
Related Sequences to LMP013459 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47087119 | EMBL | CBF61750.1 | 259 | unnamed protein product [Rattus norvegicus] |
| GI:47087119 | EMBL | CBU86626.1 | 259 | unnamed protein product [Rattus norvegicus] |
| GI:47087119 | GenBank | AGX53512.1 | 259 | Sequence 7393 from patent US 8541208 |
| GI:47087119 | SwissProt | Q6MGB5.1 | 259 | RecName: Full=Estradiol 17-beta-dehydrogenase 8; AltName: Full=17-beta-hydroxysteroid dehydrogenase 8; Short=17-beta-HSD 8; AltName: Full=3-oxoacyl-[acyl-carrier-protein] reductase; AltName: Full=Testosterone 17-beta-dehydrogenase 8 [Rattus norvegicus] |