Gene/Proteome Database (LMPD)

LMPD ID
LMP013462
Gene ID
361895
Species
Rattus norvegicus (Rat)
Gene Name
ELOVL fatty acid elongase 7
Gene Symbol
Elovl7
Alternate Names
elongation of very long chain fatty acids protein 7; ELOVL FA elongase 7; 3-keto acyl-CoA synthase Elovl7; very-long-chain 3-oxoacyl-CoA synthase 7;
Chromosome
2
Map Location
2q14
EC Number
2.3.1.199

Proteins

elongation of very long chain fatty acids protein 7
Refseq ID NP_001178773
Protein GI 300797609
UniProt ID D4ADY9
mRNA ID NM_001191844
Length 281
MAFSDLTSRTVRFYDNWIKDADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMENGNCKSKHH

Gene Information

Entrez Gene ID
361895
Gene Name
ELOVL fatty acid elongase 7
Gene Symbol
Elovl7
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
M00415 Fatty acid biosynthesis, elongation, endoplasmic reticulum
ko00062 Fatty acid elongation
rno00062 Fatty acid elongation

REACTOME Pathway Links

REACTOME Pathway ID Description
5953463 Fatty Acyl-CoA Biosynthesis
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953471 Synthesis of very long-chain fatty acyl-CoAs
5953464 Triglyceride Biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL fatty acid elongase 7
Protein Entry
ELOV7_RAT
UniProt ID
D4ADY9
Species
Rat

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Domain The di-lysine motif may confer endoplasmic reticulum localization
Function Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs (By similarity)
Similarity Belongs to the ELO family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP013462 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
300797609 RefSeq NP_001178773 281 elongation of very long chain fatty acids protein 7

Identical Sequences to LMP013462 proteins

Reference Database Accession Length Protein Name
GI:300797609 SwissProt D4ADY9.1 281 RecName: Full=Elongation of very long chain fatty acids protein 7; AltName: Full=3-keto acyl-CoA synthase Elovl7; AltName: Full=ELOVL fatty acid elongase 7; Short=ELOVL FA elongase 7; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 7 [Rattus norvegicus]

Related Sequences to LMP013462 proteins

Reference Database Accession Length Protein Name
GI:300797609 GenBank EDL18446.1 281 ELOVL family member 7, elongation of long chain fatty acids (yeast), isoform CRA_b [Mus musculus]
GI:300797609 RefSeq NP_083277.3 281 elongation of very long chain fatty acids protein 7 [Mus musculus]
GI:300797609 SwissProt Q9D2Y9.1 281 RecName: Full=Elongation of very long chain fatty acids protein 7; AltName: Full=3-keto acyl-CoA synthase Elovl7; AltName: Full=ELOVL fatty acid elongase 7; Short=ELOVL FA elongase 7; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 7 [Mus musculus]
GI:300797609 SwissProt D4ADY9.1 281 RecName: Full=Elongation of very long chain fatty acids protein 7; AltName: Full=3-keto acyl-CoA synthase Elovl7; AltName: Full=ELOVL fatty acid elongase 7; Short=ELOVL FA elongase 7; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 7 [Rattus norvegicus]