Gene/Proteome Database (LMPD)
Proteins
| phosphatidylinositol N-acetylglucosaminyltransferase subunit H | |
|---|---|
| Refseq ID | NP_001102184 |
| Protein GI | 157823401 |
| UniProt ID | D4A0Z0 |
| mRNA ID | NM_001108714 |
| Length | 188 |
| MEDEKSFSDICGGRLALRRRYYSPYCREFGLSSARLSLWSLTAVTCTVWLAAYGLFTLCENSMILSAAIFITILGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMNKVKDIIINEAIYMQKVIYYLCILLKDPGKPHEISQVVPVFQSAKPRLDCLIEIYRSCQEILAHQKATPTSL | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class H
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000506 | IEA:Ensembl | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
| GO:0017176 | IEA:InterPro | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| rno00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR019328 | GPI-GlcNAc transferase complex, PIG-H component, conserved domain |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class H
Protein Entry
D4A0Z0_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013487 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157823401 | RefSeq | NP_001102184 | 188 | phosphatidylinositol N-acetylglucosaminyltransferase subunit H |
Identical Sequences to LMP013487 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157823401 | GenBank | EDM03717.1 | 188 | phosphatidylinositol glycan, class H (predicted), isoform CRA_a [Rattus norvegicus] |
Related Sequences to LMP013487 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157823401 | GenBank | EDM03717.1 | 188 | phosphatidylinositol glycan, class H (predicted), isoform CRA_a [Rattus norvegicus] |
| GI:157823401 | GenBank | EGV91866.1 | 188 | Phosphatidylinositol N-acetylglucosaminyltransferase subunit H [Cricetulus griseus] |
| GI:157823401 | RefSeq | XP_003498315.1 | 188 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit H isoform X1 [Cricetulus griseus] |
| GI:157823401 | RefSeq | XP_005343315.1 | 188 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit H [Microtus ochrogaster] |