Gene/Proteome Database (LMPD)

LMPD ID
LMP013487
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class H
Gene Symbol
Alternate Names
phosphatidylinositol N-acetylglucosaminyltransferase subunit H; phosphatidylinositol glycan, class H;
Chromosome
6
Map Location
6q24

Proteins

phosphatidylinositol N-acetylglucosaminyltransferase subunit H
Refseq ID NP_001102184
Protein GI 157823401
UniProt ID D4A0Z0
mRNA ID NM_001108714
Length 188
MEDEKSFSDICGGRLALRRRYYSPYCREFGLSSARLSLWSLTAVTCTVWLAAYGLFTLCENSMILSAAIFITILGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMNKVKDIIINEAIYMQKVIYYLCILLKDPGKPHEISQVVPVFQSAKPRLDCLIEIYRSCQEILAHQKATPTSL

Gene Information

Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class H
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000506 IEA:Ensembl C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0017176 IEA:InterPro F phosphatidylinositol N-acetylglucosaminyltransferase activity

KEGG Pathway Links

KEGG Pathway ID Description
ko00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
rno00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5953345 Metabolism of proteins
5953735 Post-translational modification: synthesis of GPI-anchored proteins
5953728 Post-translational protein modification
5953734 Synthesis of glycosylphosphatidylinositol (GPI)

Domain Information

InterPro Annotations

Accession Description
IPR019328 GPI-GlcNAc transferase complex, PIG-H component, conserved domain

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class H
Protein Entry
D4A0Z0_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013487 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157823401 RefSeq NP_001102184 188 phosphatidylinositol N-acetylglucosaminyltransferase subunit H

Identical Sequences to LMP013487 proteins

Reference Database Accession Length Protein Name
GI:157823401 GenBank EDM03717.1 188 phosphatidylinositol glycan, class H (predicted), isoform CRA_a [Rattus norvegicus]

Related Sequences to LMP013487 proteins

Reference Database Accession Length Protein Name
GI:157823401 GenBank EDM03717.1 188 phosphatidylinositol glycan, class H (predicted), isoform CRA_a [Rattus norvegicus]
GI:157823401 GenBank EGV91866.1 188 Phosphatidylinositol N-acetylglucosaminyltransferase subunit H [Cricetulus griseus]
GI:157823401 RefSeq XP_003498315.1 188 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit H isoform X1 [Cricetulus griseus]
GI:157823401 RefSeq XP_005343315.1 188 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit H [Microtus ochrogaster]