Gene/Proteome Database (LMPD)

LMPD ID
LMP013512
Gene ID
364032
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Gene Symbol
Pigc
Alternate Names
phosphatidylinositol N-acetylglucosaminyltransferase subunit C; PIG-C; phosphatidylinositol glycan, class C; phosphatidylinositol-glycan biosynthesis class C protein;
Chromosome
13
Map Location
13q22
EC Number
2.4.1.198

Proteins

phosphatidylinositol N-acetylglucosaminyltransferase subunit C
Refseq ID NP_001012207
Protein GI 58865982
UniProt ID Q5PQQ4
mRNA ID NM_001012207
Length 297
MCAQHVADTSEVKWQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRKKSGRTRWADLKSTLVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKAYTPRSYVGVTLLFAFSAFGGLLSISGVGAILFALLLFSISCLCPYYLIHLQLFKENIHGPWDEAEIKEDLSRFLS

Gene Information

Entrez Gene ID
364032
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Gene Symbol
Pigc
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000506 IEA:Ensembl C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0017176 IEA:UniProtKB-EC F phosphatidylinositol N-acetylglucosaminyltransferase activity
GO:0006506 IEA:UniProtKB-UniPathway P GPI anchor biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
rno00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5953345 Metabolism of proteins
5953735 Post-translational modification: synthesis of GPI-anchored proteins
5953728 Post-translational protein modification
5953734 Synthesis of glycosylphosphatidylinositol (GPI)

Domain Information

InterPro Annotations

Accession Description
IPR009450 Phosphatidylinositol N-acetylglucosaminyltransferase subunit C

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Protein Entry
PIGC_RAT
UniProt ID
Q5PQQ4
Species
Rat

Comments

Comment Type Description
Catalytic Activity UDP-N-acetyl-D-glucosamine + 1-phosphatidyl- 1D-myo-inositol = UDP + 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol.
Function Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis
Pathway Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis.
Similarity Belongs to the PIGC family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein .
Subunit Associates with PIGA, PIGH, PIGP, PIGQ and DPM2. The latter is not essential for activity (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP013512 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58865982 RefSeq NP_001012207 297 phosphatidylinositol N-acetylglucosaminyltransferase subunit C

Identical Sequences to LMP013512 proteins

Reference Database Accession Length Protein Name
GI:58865982 GenBank EDM09410.1 297 rCG46011 [Rattus norvegicus]
GI:58865982 RefSeq XP_006250244.1 297 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform X1 [Rattus norvegicus]
GI:58865982 RefSeq XP_006250245.1 297 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform X1 [Rattus norvegicus]
GI:58865982 RefSeq XP_008767887.1 297 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform X1 [Rattus norvegicus]

Related Sequences to LMP013512 proteins

Reference Database Accession Length Protein Name
GI:58865982 GenBank AAH87080.1 297 Phosphatidylinositol glycan anchor biosynthesis, class C [Rattus norvegicus]
GI:58865982 RefSeq XP_006250244.1 297 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform X1 [Rattus norvegicus]
GI:58865982 RefSeq XP_006250245.1 297 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform X1 [Rattus norvegicus]
GI:58865982 SwissProt Q5PQQ4.1 297 RecName: Full=Phosphatidylinositol N-acetylglucosaminyltransferase subunit C; AltName: Full=Phosphatidylinositol-glycan biosynthesis class C protein; Short=PIG-C [Rattus norvegicus]