Gene/Proteome Database (LMPD)
LMPD ID
LMP013534
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
coenzyme Q4
Gene Symbol
Alternate Names
ubiquinone biosynthesis protein COQ4 homolog, mitochondrial; coenzyme Q4 homolog; coenzyme Q biosynthesis protein 4 homolog {ECO:0000255|HAMAP-Rule:MF_03111}; ubiquinone biosynthesis protein COQ4 homolog, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03111};
Chromosome
3
Map Location
3p12
Proteins
| ubiquinone biosynthesis protein COQ4 homolog, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_001026832 |
| Protein GI | 72255545 |
| UniProt ID | Q4FZU1 |
| mRNA ID | NM_001031662 |
| Length | 265 |
| MATLLLRSQRLHRSLRHRTRPTVDVLLRAASHGARLLYPDHIPTTPLQKMLLAAGAAGMALYNPYRHDMVAVLGETTGCHTLKFLRDQMKKDPEGAQILQERPRISLSTLDLSKLQSLPEGSLGREYLRFLNANKVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGALFGPVRLRAQSLQVLFSELIPWAIQNGRRAPCVLNIYYEQRWEQPLTALREELGISPPPKHIQGLA | |
| transit_peptide: 1..29 experiment: experimental evidence, no additional details recorded note: Mitochondrion. {ECO:0000255|HAMAP-Rule:MF_03111}; propagated from UniProtKB/Swiss-Prot (Q4FZU1.1) calculated_mol_wt: 3467 peptide sequence: MATLLLRSQRLHRSLRHRTRPTVDVLLRA mat_peptide: 30..265 product: Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q4FZU1.1) calculated_mol_wt: 26564 peptide sequence: ASHGARLLYPDHIPTTPLQKMLLAAGAAGMALYNPYRHDMVAVLGETTGCHTLKFLRDQMKKDPEGAQILQERPRISLSTLDLSKLQSLPEGSLGREYLRFLNANKVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGALFGPVRLRAQSLQVLFSELIPWAIQNGRRAPCVLNIYYEQRWEQPLTALREELGISPPPKHIQGLA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031314 | IEA:UniProtKB-HAMAP | C | extrinsic component of mitochondrial inner membrane |
| GO:0006744 | IEA:UniProtKB-HAMAP | P | ubiquinone biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides. {ECO:0000255|HAMAP- Rule:MF_03111}. |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis |
| Similarity | Belongs to the COQ4 family. {ECO:0000255|HAMAP- Rule:MF_03111}. |
| Subcellular Location | Mitochondrion inner membrane ; Peripheral membrane protein ; Matrix side {ECO:0000255|HAMAP- Rule:MF_03111}. |
| Subunit | Component of a multi-subunit COQ enzyme complex, composed of at least COQ3, COQ4, COQ5, COQ6, COQ7 and COQ9 |
Identical and Related Proteins
Unique RefSeq proteins for LMP013534 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 72255545 | RefSeq | NP_001026832 | 265 | ubiquinone biosynthesis protein COQ4 homolog, mitochondrial precursor |
Identical Sequences to LMP013534 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:72255545 | GenBank | AAH99123.1 | 265 | Coenzyme Q4 homolog (S. cerevisiae) [Rattus norvegicus] |
| GI:72255545 | SwissProt | Q4FZU1.1 | 265 | RecName: Full=Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial; AltName: Full=Coenzyme Q biosynthesis protein 4 homolog; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP013534 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:72255545 | DBBJ | BAC30416.1 | 266 | unnamed protein product [Mus musculus] |
| GI:72255545 | GenBank | AAH99123.1 | 265 | Coenzyme Q4 homolog (S. cerevisiae) [Rattus norvegicus] |
| GI:72255545 | GenBank | EDL93374.1 | 269 | coenzyme Q4 homolog (yeast) [Rattus norvegicus] |
| GI:72255545 | SwissProt | Q4FZU1.1 | 265 | RecName: Full=Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial; AltName: Full=Coenzyme Q biosynthesis protein 4 homolog; Flags: Precursor [Rattus norvegicus] |