Gene/Proteome Database (LMPD)

LMPD ID
LMP013534
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
coenzyme Q4
Gene Symbol
Alternate Names
ubiquinone biosynthesis protein COQ4 homolog, mitochondrial; coenzyme Q4 homolog; coenzyme Q biosynthesis protein 4 homolog {ECO:0000255|HAMAP-Rule:MF_03111}; ubiquinone biosynthesis protein COQ4 homolog, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03111};
Chromosome
3
Map Location
3p12

Proteins

ubiquinone biosynthesis protein COQ4 homolog, mitochondrial precursor
Refseq ID NP_001026832
Protein GI 72255545
UniProt ID Q4FZU1
mRNA ID NM_001031662
Length 265
MATLLLRSQRLHRSLRHRTRPTVDVLLRAASHGARLLYPDHIPTTPLQKMLLAAGAAGMALYNPYRHDMVAVLGETTGCHTLKFLRDQMKKDPEGAQILQERPRISLSTLDLSKLQSLPEGSLGREYLRFLNANKVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGALFGPVRLRAQSLQVLFSELIPWAIQNGRRAPCVLNIYYEQRWEQPLTALREELGISPPPKHIQGLA
transit_peptide: 1..29 experiment: experimental evidence, no additional details recorded note: Mitochondrion. {ECO:0000255|HAMAP-Rule:MF_03111}; propagated from UniProtKB/Swiss-Prot (Q4FZU1.1) calculated_mol_wt: 3467 peptide sequence: MATLLLRSQRLHRSLRHRTRPTVDVLLRA mat_peptide: 30..265 product: Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q4FZU1.1) calculated_mol_wt: 26564 peptide sequence: ASHGARLLYPDHIPTTPLQKMLLAAGAAGMALYNPYRHDMVAVLGETTGCHTLKFLRDQMKKDPEGAQILQERPRISLSTLDLSKLQSLPEGSLGREYLRFLNANKVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNMLGEVVVKWFEAVQTGLPMCILGALFGPVRLRAQSLQVLFSELIPWAIQNGRRAPCVLNIYYEQRWEQPLTALREELGISPPPKHIQGLA

Gene Information

Entrez Gene ID
Gene Name
coenzyme Q4
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031314 IEA:UniProtKB-HAMAP C extrinsic component of mitochondrial inner membrane
GO:0006744 IEA:UniProtKB-HAMAP P ubiquinone biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR007715 Ubiquinone biosynthesis protein Coq4
IPR027540 Ubiquinone biosynthesis protein Coq4, eukaryotes

UniProt Annotations

Entry Information

Gene Name
coenzyme Q4
Protein Entry
COQ4_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides. {ECO:0000255|HAMAP- Rule:MF_03111}.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis
Similarity Belongs to the COQ4 family. {ECO:0000255|HAMAP- Rule:MF_03111}.
Subcellular Location Mitochondrion inner membrane ; Peripheral membrane protein ; Matrix side {ECO:0000255|HAMAP- Rule:MF_03111}.
Subunit Component of a multi-subunit COQ enzyme complex, composed of at least COQ3, COQ4, COQ5, COQ6, COQ7 and COQ9

Identical and Related Proteins

Unique RefSeq proteins for LMP013534 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
72255545 RefSeq NP_001026832 265 ubiquinone biosynthesis protein COQ4 homolog, mitochondrial precursor

Identical Sequences to LMP013534 proteins

Reference Database Accession Length Protein Name
GI:72255545 GenBank AAH99123.1 265 Coenzyme Q4 homolog (S. cerevisiae) [Rattus norvegicus]
GI:72255545 SwissProt Q4FZU1.1 265 RecName: Full=Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial; AltName: Full=Coenzyme Q biosynthesis protein 4 homolog; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP013534 proteins

Reference Database Accession Length Protein Name
GI:72255545 DBBJ BAC30416.1 266 unnamed protein product [Mus musculus]
GI:72255545 GenBank AAH99123.1 265 Coenzyme Q4 homolog (S. cerevisiae) [Rattus norvegicus]
GI:72255545 GenBank EDL93374.1 269 coenzyme Q4 homolog (yeast) [Rattus norvegicus]
GI:72255545 SwissProt Q4FZU1.1 265 RecName: Full=Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial; AltName: Full=Coenzyme Q biosynthesis protein 4 homolog; Flags: Precursor [Rattus norvegicus]