Gene/Proteome Database (LMPD)
Proteins
| cardiolipin synthase | |
|---|---|
| Refseq ID | NP_001014280 |
| Protein GI | 62079247 |
| UniProt ID | Q5U2V5 |
| mRNA ID | NM_001014258 |
| Length | 302 |
| MLAWRVARGAWGSLRVAVRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRLPGTSPRTHCSGAGKAAPEPAAGGDAAAQAPSARWVRASATSSYENPWTIPNLLSMTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIKGK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005743 | IEA:UniProtKB-KW | C | mitochondrial inner membrane |
| GO:0016780 | IEA:InterPro | F | phosphotransferase activity, for other substituted phosphate groups |
| GO:0008654 | IEA:UniProtKB-KW | P | phospholipid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00564 | Glycerophospholipid metabolism |
| rno00564 | Glycerophospholipid metabolism |
| rno01100 | Metabolic pathways |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000462 | CDP-alcohol phosphatidyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2 Phosphatidylglycerol = diphosphatidylglycerol + glycerol. |
| Function | Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol. |
| Similarity | Belongs to the CDP-alcohol phosphatidyltransferase class-I family |
| Subcellular Location | Mitochondrion inner membrane ; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013536 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 62079247 | RefSeq | NP_001014280 | 302 | cardiolipin synthase |
Identical Sequences to LMP013536 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62079247 | GenBank | AAH85849.1 | 302 | Cardiolipin synthase 1 [Rattus norvegicus] |
| GI:62079247 | GenBank | EDL80276.1 | 302 | similar to chromosome 20 open reading frame 155 [Rattus norvegicus] |
| GI:62079247 | SwissProt | Q5U2V5.1 | 302 | RecName: Full=Cardiolipin synthase; Short=CLS [Rattus norvegicus] |
Related Sequences to LMP013536 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62079247 | GenBank | AAH85849.1 | 302 | Cardiolipin synthase 1 [Rattus norvegicus] |
| GI:62079247 | GenBank | EDL80276.1 | 302 | similar to chromosome 20 open reading frame 155 [Rattus norvegicus] |
| GI:62079247 | RefSeq | NP_001019556.1 | 303 | cardiolipin synthase isoform 1 [Mus musculus] |
| GI:62079247 | SwissProt | Q5U2V5.1 | 302 | RecName: Full=Cardiolipin synthase; Short=CLS [Rattus norvegicus] |