Gene/Proteome Database (LMPD)
Proteins
| serine palmitoyltransferase small subunit A | |
|---|---|
| Refseq ID | NP_001041208 |
| Protein GI | 114145575 |
| UniProt ID | Q4G019 |
| mRNA ID | NM_001047743 |
| Length | 71 |
| MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSVVGMALYTGYVFMPQHIMAILHYFEIVQ | |
Gene Information
Entrez Gene ID
Gene Name
serine palmitoyltransferase, small subunit A
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0017059 | ISS:UniProtKB | C | serine C-palmitoyltransferase complex |
| GO:0004758 | IEA:Ensembl | F | serine C-palmitoyltransferase activity |
| GO:0006665 | IEA:UniProtKB-UniPathway | P | sphingolipid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR024512 | Small subunit of serine palmitoyltransferase-like |
UniProt Annotations
Entry Information
Gene Name
serine palmitoyltransferase, small subunit A
Protein Entry
SPTSA_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Caution | It is uncertain whether Met-1 or Met-4 is the initiator |
| Function | Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2- SPTSSA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC3-SPTSSA isozyme uses both C14-CoA and C16- CoA as substrates, with a slight preference for C14-CoA (By similarity) |
| Pathway | Lipid metabolism; sphingolipid metabolism. |
| Sequence Caution | Sequence=AAH98829.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; |
| Similarity | Belongs to the SPTSS family. SPTSSA subfamily |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein . |
| Subunit | Interacts with SPTLC1; the interaction is direct. Component of the serine palmitoyltransferase (SPT) complex, composed of SPTLC1, either SPTLC2 or SPTLC3, and either SPTSSA or SPTSSB (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP013595 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 114145575 | RefSeq | NP_001041208 | 71 | serine palmitoyltransferase small subunit A |
Identical Sequences to LMP013595 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:114145575 | RefSeq | XP_005080556.1 | 71 | PREDICTED: serine palmitoyltransferase small subunit A [Mesocricetus auratus] |
| GI:114145575 | RefSeq | XP_005322728.1 | 71 | PREDICTED: serine palmitoyltransferase small subunit A [Ictidomys tridecemlineatus] |
| GI:114145575 | RefSeq | XP_006975339.1 | 71 | PREDICTED: serine palmitoyltransferase small subunit A [Peromyscus maniculatus bairdii] |
| GI:114145575 | RefSeq | XP_008831787.1 | 71 | PREDICTED: serine palmitoyltransferase small subunit A [Nannospalax galili] |
Related Sequences to LMP013595 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:114145575 | GenBank | EDL36749.1 | 71 | RIKEN cDNA 1110002B05 [Mus musculus] |
| GI:114145575 | GenBank | EDM03407.1 | 71 | LOC500651 [Rattus norvegicus] |
| GI:114145575 | RefSeq | NP_598815.2 | 71 | serine palmitoyltransferase small subunit A [Mus musculus] |
| GI:114145575 | RefSeq | XP_008831787.1 | 71 | PREDICTED: serine palmitoyltransferase small subunit A [Nannospalax galili] |